BLASTX nr result
ID: Forsythia21_contig00037059
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00037059 (297 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAM86776.1| hypothetical protein ANO11243_047960 [fungal sp.... 76 8e-12 ref|XP_002582873.1| 60S ribosomal protein L33-A [Uncinocarpus re... 76 1e-11 gb|KKY20527.1| putative 60s ribosomal protein l33 [Diplodia seri... 75 1e-11 gb|KEQ94619.1| hypothetical protein AUEXF2481DRAFT_80298 [Aureob... 75 1e-11 gb|KEQ80269.1| 60S ribosomal protein L33-A [Aureobasidium pullul... 75 1e-11 gb|KEQ76225.1| 60S ribosomal protein L33-A [Aureobasidium namibi... 75 1e-11 gb|KEQ61793.1| 60S ribosomal protein L33 [Aureobasidium melanoge... 75 1e-11 ref|XP_007586029.1| putative 60s ribosomal protein l33 protein [... 75 2e-11 gb|EKG15894.1| Ribosomal protein L35A [Macrophomina phaseolina MS6] 75 2e-11 emb|CEJ57293.1| Putative 60S ribosomal protein L33-A [Penicilliu... 74 3e-11 dbj|GAO85447.1| 60S ribosomal protein L33-A [Neosartorya udagawae] 74 3e-11 ref|XP_002373577.1| 60S ribosomal protein L33 [Aspergillus flavu... 74 3e-11 ref|XP_754768.1| 60S ribosomal protein L35Ae [Aspergillus fumiga... 74 3e-11 ref|XP_001263593.1| 60S ribosomal protein L33 [Neosartorya fisch... 74 3e-11 ref|XP_001270866.1| 60S ribosomal protein L33 [Aspergillus clava... 74 3e-11 ref|XP_001208989.1| 60S ribosomal protein L33 [Aspergillus terre... 74 3e-11 gb|EGD86711.2| hypothetical protein TERG_02971 [Trichophyton rub... 74 4e-11 gb|EZF20544.1| 60S ribosomal protein L33-A [Trichophyton rubrum ... 74 4e-11 gb|EGE03723.1| 60S ribosomal protein L35a [Trichophyton equinum ... 74 4e-11 gb|EGD99236.1| 60S ribosomal protein L35a [Trichophyton tonsuran... 74 4e-11 >dbj|GAM86776.1| hypothetical protein ANO11243_047960 [fungal sp. No.11243] Length = 109 Score = 76.3 bits (186), Expect = 8e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 296 VTRPHGNSGVVRAQFRNNLPPRSFGATVRVMLYPSSI 186 VTRPHGNSGVVRA FRNNLPPRSFGATVR+MLYPSSI Sbjct: 73 VTRPHGNSGVVRAHFRNNLPPRSFGATVRIMLYPSSI 109 >ref|XP_002582873.1| 60S ribosomal protein L33-A [Uncinocarpus reesii 1704] gi|237908380|gb|EEP82781.1| 60S ribosomal protein L33-A [Uncinocarpus reesii 1704] Length = 109 Score = 75.9 bits (185), Expect = 1e-11 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -2 Query: 296 VTRPHGNSGVVRAQFRNNLPPRSFGATVRVMLYPSSI 186 VTRPHGNSGVVRAQFRNNLPP+SFGA+VRVMLYPSSI Sbjct: 73 VTRPHGNSGVVRAQFRNNLPPKSFGASVRVMLYPSSI 109 >gb|KKY20527.1| putative 60s ribosomal protein l33 [Diplodia seriata] Length = 109 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -2 Query: 296 VTRPHGNSGVVRAQFRNNLPPRSFGATVRVMLYPSSI 186 VTRPHGNSGVVRAQFRNNLPP+SFGA+VR+MLYPSSI Sbjct: 73 VTRPHGNSGVVRAQFRNNLPPKSFGASVRIMLYPSSI 109 >gb|KEQ94619.1| hypothetical protein AUEXF2481DRAFT_80298 [Aureobasidium subglaciale EXF-2481] Length = 109 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -2 Query: 296 VTRPHGNSGVVRAQFRNNLPPRSFGATVRVMLYPSSI 186 VTR HGNSGVVRAQFRNNLPPRSFGATVRVMLYPSSI Sbjct: 73 VTRAHGNSGVVRAQFRNNLPPRSFGATVRVMLYPSSI 109 >gb|KEQ80269.1| 60S ribosomal protein L33-A [Aureobasidium pullulans EXF-150] Length = 112 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -2 Query: 296 VTRPHGNSGVVRAQFRNNLPPRSFGATVRVMLYPSSI 186 VTR HGNSGVVRAQFRNNLPPRSFGATVRVMLYPSSI Sbjct: 76 VTRAHGNSGVVRAQFRNNLPPRSFGATVRVMLYPSSI 112 >gb|KEQ76225.1| 60S ribosomal protein L33-A [Aureobasidium namibiae CBS 147.97] Length = 109 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -2 Query: 296 VTRPHGNSGVVRAQFRNNLPPRSFGATVRVMLYPSSI 186 VTR HGNSGVVRAQFRNNLPPRSFGATVRVMLYPSSI Sbjct: 73 VTRAHGNSGVVRAQFRNNLPPRSFGATVRVMLYPSSI 109 >gb|KEQ61793.1| 60S ribosomal protein L33 [Aureobasidium melanogenum CBS 110374] Length = 110 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -2 Query: 296 VTRPHGNSGVVRAQFRNNLPPRSFGATVRVMLYPSSI 186 VTR HGNSGVVRAQFRNNLPPRSFGATVRVMLYPSSI Sbjct: 74 VTRAHGNSGVVRAQFRNNLPPRSFGATVRVMLYPSSI 110 >ref|XP_007586029.1| putative 60s ribosomal protein l33 protein [Neofusicoccum parvum UCRNP2] gi|485920429|gb|EOD46451.1| putative 60s ribosomal protein l33 protein [Neofusicoccum parvum UCRNP2] Length = 109 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -2 Query: 296 VTRPHGNSGVVRAQFRNNLPPRSFGATVRVMLYPSSI 186 VTRPHGNSGVVRAQFRNNLPP+SFGA+VR+MLYPSSI Sbjct: 73 VTRPHGNSGVVRAQFRNNLPPQSFGASVRIMLYPSSI 109 >gb|EKG15894.1| Ribosomal protein L35A [Macrophomina phaseolina MS6] Length = 109 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -2 Query: 296 VTRPHGNSGVVRAQFRNNLPPRSFGATVRVMLYPSSI 186 VTRPHGNSGVVRAQFRNNLPP+SFGA+VR+MLYPSSI Sbjct: 73 VTRPHGNSGVVRAQFRNNLPPQSFGASVRIMLYPSSI 109 >emb|CEJ57293.1| Putative 60S ribosomal protein L33-A [Penicillium brasilianum] Length = 109 Score = 74.3 bits (181), Expect = 3e-11 Identities = 33/37 (89%), Positives = 37/37 (100%) Frame = -2 Query: 296 VTRPHGNSGVVRAQFRNNLPPRSFGATVRVMLYPSSI 186 VTRPHGNSGVVRA+FRNNLPP+SFGATVR+MLYPS+I Sbjct: 73 VTRPHGNSGVVRAKFRNNLPPKSFGATVRIMLYPSNI 109 >dbj|GAO85447.1| 60S ribosomal protein L33-A [Neosartorya udagawae] Length = 109 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -2 Query: 296 VTRPHGNSGVVRAQFRNNLPPRSFGATVRVMLYPSSI 186 VTRPHGNSGVVRAQFR+NLPP+SFGATVRVMLYPS+I Sbjct: 73 VTRPHGNSGVVRAQFRHNLPPKSFGATVRVMLYPSNI 109 >ref|XP_002373577.1| 60S ribosomal protein L33 [Aspergillus flavus NRRL3357] gi|317140684|ref|XP_003189289.1| 60S ribosomal protein L33 [Aspergillus oryzae RIB40] gi|220701627|gb|EED57965.1| 60S ribosomal protein L35Ae [Aspergillus flavus NRRL3357] Length = 109 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -2 Query: 296 VTRPHGNSGVVRAQFRNNLPPRSFGATVRVMLYPSSI 186 VTRPHGNSGVVRAQFR+NLPP+SFGATVRVMLYPS+I Sbjct: 73 VTRPHGNSGVVRAQFRHNLPPKSFGATVRVMLYPSNI 109 >ref|XP_754768.1| 60S ribosomal protein L35Ae [Aspergillus fumigatus Af293] gi|66852405|gb|EAL92730.1| 60S ribosomal protein L35Ae [Aspergillus fumigatus Af293] gi|159127776|gb|EDP52891.1| 60S ribosomal protein L35Ae [Aspergillus fumigatus A1163] gi|666430954|gb|KEY78569.1| 60S ribosomal protein L35Ae [Aspergillus fumigatus var. RP-2014] Length = 119 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -2 Query: 296 VTRPHGNSGVVRAQFRNNLPPRSFGATVRVMLYPSSI 186 VTRPHGNSGVVRAQFR+NLPP+SFGATVRVMLYPS+I Sbjct: 83 VTRPHGNSGVVRAQFRHNLPPKSFGATVRVMLYPSNI 119 >ref|XP_001263593.1| 60S ribosomal protein L33 [Neosartorya fischeri NRRL 181] gi|119411753|gb|EAW21696.1| 60S ribosomal protein L35a [Neosartorya fischeri NRRL 181] gi|846914672|gb|KMK60490.1| 60S ribosomal protein L35a [Aspergillus fumigatus Z5] Length = 109 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -2 Query: 296 VTRPHGNSGVVRAQFRNNLPPRSFGATVRVMLYPSSI 186 VTRPHGNSGVVRAQFR+NLPP+SFGATVRVMLYPS+I Sbjct: 73 VTRPHGNSGVVRAQFRHNLPPKSFGATVRVMLYPSNI 109 >ref|XP_001270866.1| 60S ribosomal protein L33 [Aspergillus clavatus NRRL 1] gi|119399012|gb|EAW09440.1| 60S ribosomal protein L35a [Aspergillus clavatus NRRL 1] Length = 109 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -2 Query: 296 VTRPHGNSGVVRAQFRNNLPPRSFGATVRVMLYPSSI 186 VTRPHGNSGVVRAQFR+NLPP+SFGATVRVMLYPS+I Sbjct: 73 VTRPHGNSGVVRAQFRHNLPPKSFGATVRVMLYPSNI 109 >ref|XP_001208989.1| 60S ribosomal protein L33 [Aspergillus terreus NIH2624] gi|114196681|gb|EAU38381.1| 60S ribosomal protein L33-A [Aspergillus terreus NIH2624] Length = 109 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -2 Query: 296 VTRPHGNSGVVRAQFRNNLPPRSFGATVRVMLYPSSI 186 VTRPHGNSGVVRAQFR+NLPP+SFGATVRVMLYPS+I Sbjct: 73 VTRPHGNSGVVRAQFRHNLPPKSFGATVRVMLYPSNI 109 >gb|EGD86711.2| hypothetical protein TERG_02971 [Trichophyton rubrum CBS 118892] Length = 137 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -2 Query: 296 VTRPHGNSGVVRAQFRNNLPPRSFGATVRVMLYPSSI 186 VTRPHGNSGVVRAQFR+NLPP+SFGA+VRVMLYPSSI Sbjct: 101 VTRPHGNSGVVRAQFRHNLPPKSFGASVRVMLYPSSI 137 >gb|EZF20544.1| 60S ribosomal protein L33-A [Trichophyton rubrum MR850] gi|607903355|gb|EZF40848.1| 60S ribosomal protein L33-A [Trichophyton rubrum CBS 100081] gi|607915730|gb|EZF51756.1| 60S ribosomal protein L33-A [Trichophyton rubrum CBS 288.86] gi|607927575|gb|EZF62164.1| 60S ribosomal protein L33-A [Trichophyton rubrum CBS 289.86] gi|607939723|gb|EZF73002.1| 60S ribosomal protein L33-A [Trichophyton soudanense CBS 452.61] gi|607951484|gb|EZF83412.1| 60S ribosomal protein L33-A [Trichophyton rubrum MR1448] gi|607963909|gb|EZF94366.1| 60S ribosomal protein L33-A [Trichophyton rubrum MR1459] gi|607976132|gb|EZG05343.1| 60S ribosomal protein L33-A [Trichophyton rubrum CBS 735.88] gi|607987614|gb|EZG15641.1| 60S ribosomal protein L33-A [Trichophyton rubrum CBS 202.88] gi|633057688|gb|KDB32599.1| 60S ribosomal protein L33-A [Trichophyton rubrum D6] gi|861301654|gb|KMQ45836.1| Ribosomal protein L35A [Trichophyton rubrum] Length = 109 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -2 Query: 296 VTRPHGNSGVVRAQFRNNLPPRSFGATVRVMLYPSSI 186 VTRPHGNSGVVRAQFR+NLPP+SFGA+VRVMLYPSSI Sbjct: 73 VTRPHGNSGVVRAQFRHNLPPKSFGASVRVMLYPSSI 109 >gb|EGE03723.1| 60S ribosomal protein L35a [Trichophyton equinum CBS 127.97] gi|607896056|gb|EZF34635.1| 60S ribosomal protein L33-A [Trichophyton interdigitale H6] gi|633044505|gb|KDB21549.1| 60S ribosomal protein L33-A [Trichophyton interdigitale MR816] Length = 109 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -2 Query: 296 VTRPHGNSGVVRAQFRNNLPPRSFGATVRVMLYPSSI 186 VTRPHGNSGVVRAQFR+NLPP+SFGA+VRVMLYPSSI Sbjct: 73 VTRPHGNSGVVRAQFRHNLPPKSFGASVRVMLYPSSI 109 >gb|EGD99236.1| 60S ribosomal protein L35a [Trichophyton tonsurans CBS 112818] Length = 110 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -2 Query: 296 VTRPHGNSGVVRAQFRNNLPPRSFGATVRVMLYPSSI 186 VTRPHGNSGVVRAQFR+NLPP+SFGA+VRVMLYPSSI Sbjct: 74 VTRPHGNSGVVRAQFRHNLPPKSFGASVRVMLYPSSI 110