BLASTX nr result
ID: Forsythia21_contig00037019
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00037019 (388 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006440570.1| hypothetical protein CICLE_v10024020mg [Citr... 63 9e-08 ref|XP_011081003.1| PREDICTED: CASP-like protein 4A4 [Sesamum in... 58 3e-06 >ref|XP_006440570.1| hypothetical protein CICLE_v10024020mg [Citrus clementina] gi|568847206|ref|XP_006477429.1| PREDICTED: CASP-like protein At4g11655-like isoform X1 [Citrus sinensis] gi|557542832|gb|ESR53810.1| hypothetical protein CICLE_v10024020mg [Citrus clementina] gi|641844637|gb|KDO63529.1| hypothetical protein CISIN_1g028153mg [Citrus sinensis] Length = 213 Score = 62.8 bits (151), Expect = 9e-08 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +1 Query: 217 VASTRWSSRPPFQAANLFLRLLALVFSFGSTLSLAAPSPAKTMFGKSPSFY 369 VASTRWSSRP +NLFLR LALVF F S LSLAAPSP K G+ PS + Sbjct: 52 VASTRWSSRPSIHFSNLFLRFLALVFCFVSALSLAAPSPKKK--GQQPSSF 100 >ref|XP_011081003.1| PREDICTED: CASP-like protein 4A4 [Sesamum indicum] Length = 203 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/45 (66%), Positives = 32/45 (71%) Frame = +1 Query: 220 ASTRWSSRPPFQAANLFLRLLALVFSFGSTLSLAAPSPAKTMFGK 354 ASTRWSS+PP Q ANL LR LALV SF + L LAA SPA F K Sbjct: 41 ASTRWSSQPPTQTANLSLRFLALVLSFAAALQLAAISPATAKFKK 85