BLASTX nr result
ID: Forsythia21_contig00034448
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00034448 (341 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ77668.1| hypothetical protein M436DRAFT_59637 [Aureobasidi... 71 3e-10 gb|KEQ67523.1| hypothetical protein M437DRAFT_37980 [Aureobasidi... 59 1e-06 >gb|KEQ77668.1| hypothetical protein M436DRAFT_59637 [Aureobasidium namibiae CBS 147.97] Length = 573 Score = 70.9 bits (172), Expect = 3e-10 Identities = 33/39 (84%), Positives = 34/39 (87%) Frame = -3 Query: 339 GHKTTLTAPSTITSIFTSYATITAPTQGHAVPTTPGYSN 223 G KTTLTAPSTITSI TSYAT+TAPTQGH VPTTP Y N Sbjct: 295 GQKTTLTAPSTITSILTSYATVTAPTQGHVVPTTPIYGN 333 >gb|KEQ67523.1| hypothetical protein M437DRAFT_37980 [Aureobasidium melanogenum CBS 110374] Length = 613 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -3 Query: 339 GHKTTLTAPSTITSIFTSYATITAPTQGHAVPTTP 235 G KTTLT PS ITSI+TSYAT+TA TQGH VPT P Sbjct: 304 GSKTTLTTPSVITSIYTSYATLTASTQGHVVPTVP 338