BLASTX nr result
ID: Forsythia21_contig00034392
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00034392 (381 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011099935.1| PREDICTED: ubiquitin domain-containing prote... 70 7e-10 ref|XP_011099934.1| PREDICTED: ubiquitin domain-containing prote... 70 7e-10 gb|KHN41829.1| Ubiquilin-1 [Glycine soja] 69 1e-09 ref|XP_003537681.1| PREDICTED: ubiquitin domain-containing prote... 69 1e-09 ref|XP_012837250.1| PREDICTED: ubiquitin domain-containing prote... 68 2e-09 ref|XP_012837249.1| PREDICTED: ubiquitin domain-containing prote... 68 2e-09 ref|XP_010649310.1| PREDICTED: ubiquitin domain-containing prote... 68 2e-09 ref|XP_009400383.1| PREDICTED: ubiquitin domain-containing prote... 68 2e-09 ref|XP_009400382.1| PREDICTED: ubiquitin domain-containing prote... 68 2e-09 emb|CBI38418.3| unnamed protein product [Vitis vinifera] 68 2e-09 ref|XP_012837248.1| PREDICTED: ubiquitin domain-containing prote... 68 2e-09 ref|XP_010242891.1| PREDICTED: ubiquitin domain-containing prote... 68 3e-09 ref|XP_010242888.1| PREDICTED: ubiquitin domain-containing prote... 68 3e-09 ref|XP_010266172.1| PREDICTED: ubiquitin domain-containing prote... 68 3e-09 emb|CAL07979.1| putative ubiquitin protein 2 [Platanus x acerifo... 68 3e-09 ref|XP_012065449.1| PREDICTED: ubiquitin domain-containing prote... 67 5e-09 ref|XP_009766697.1| PREDICTED: ubiquitin domain-containing prote... 67 5e-09 ref|XP_009766695.1| PREDICTED: ubiquitin domain-containing prote... 67 5e-09 ref|XP_009601932.1| PREDICTED: ubiquitin domain-containing prote... 67 5e-09 ref|XP_009601930.1| PREDICTED: ubiquitin domain-containing prote... 67 5e-09 >ref|XP_011099935.1| PREDICTED: ubiquitin domain-containing protein DSK2a-like isoform X2 [Sesamum indicum] Length = 551 Score = 69.7 bits (169), Expect = 7e-10 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = -2 Query: 380 LQEMGFFDTQENIRALIASAGNVHAAVEQLLGNPGR 273 LQEMGFFDTQENIRALIA+AGN+HAAVE+LLGNPG+ Sbjct: 516 LQEMGFFDTQENIRALIATAGNIHAAVERLLGNPGQ 551 >ref|XP_011099934.1| PREDICTED: ubiquitin domain-containing protein DSK2a-like isoform X1 [Sesamum indicum] Length = 554 Score = 69.7 bits (169), Expect = 7e-10 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = -2 Query: 380 LQEMGFFDTQENIRALIASAGNVHAAVEQLLGNPGR 273 LQEMGFFDTQENIRALIA+AGN+HAAVE+LLGNPG+ Sbjct: 519 LQEMGFFDTQENIRALIATAGNIHAAVERLLGNPGQ 554 >gb|KHN41829.1| Ubiquilin-1 [Glycine soja] Length = 539 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = -2 Query: 380 LQEMGFFDTQENIRALIASAGNVHAAVEQLLGNPGR 273 LQEMGFFDTQENIRALIA++GNVHAAVE+LLGNPG+ Sbjct: 504 LQEMGFFDTQENIRALIATSGNVHAAVERLLGNPGQ 539 >ref|XP_003537681.1| PREDICTED: ubiquitin domain-containing protein DSK2b-like isoform X1 [Glycine max] gi|571487772|ref|XP_006590744.1| PREDICTED: ubiquitin domain-containing protein DSK2b-like isoform X2 [Glycine max] Length = 541 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = -2 Query: 380 LQEMGFFDTQENIRALIASAGNVHAAVEQLLGNPGR 273 LQEMGFFDTQENIRALIA++GNVHAAVE+LLGNPG+ Sbjct: 506 LQEMGFFDTQENIRALIATSGNVHAAVERLLGNPGQ 541 >ref|XP_012837250.1| PREDICTED: ubiquitin domain-containing protein DSK2b-like isoform X3 [Erythranthe guttatus] Length = 541 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/36 (86%), Positives = 36/36 (100%) Frame = -2 Query: 380 LQEMGFFDTQENIRALIASAGNVHAAVEQLLGNPGR 273 LQEMGFFDTQENIRAL+A++GNVHAAVE+LLGNPG+ Sbjct: 506 LQEMGFFDTQENIRALLATSGNVHAAVERLLGNPGQ 541 >ref|XP_012837249.1| PREDICTED: ubiquitin domain-containing protein DSK2b-like isoform X2 [Erythranthe guttatus] Length = 543 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/36 (86%), Positives = 36/36 (100%) Frame = -2 Query: 380 LQEMGFFDTQENIRALIASAGNVHAAVEQLLGNPGR 273 LQEMGFFDTQENIRAL+A++GNVHAAVE+LLGNPG+ Sbjct: 508 LQEMGFFDTQENIRALLATSGNVHAAVERLLGNPGQ 543 >ref|XP_010649310.1| PREDICTED: ubiquitin domain-containing protein DSK2b-like [Vitis vinifera] Length = 559 Score = 68.2 bits (165), Expect = 2e-09 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -2 Query: 380 LQEMGFFDTQENIRALIASAGNVHAAVEQLLGNPGR 273 LQEMGFFDTQENIRAL A+AGNVHAAVE+LLGNPG+ Sbjct: 524 LQEMGFFDTQENIRALTATAGNVHAAVERLLGNPGQ 559 >ref|XP_009400383.1| PREDICTED: ubiquitin domain-containing protein DSK2a-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 526 Score = 68.2 bits (165), Expect = 2e-09 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -2 Query: 380 LQEMGFFDTQENIRALIASAGNVHAAVEQLLGNPGR 273 LQEMGFFDTQENIRAL A+AGNVHAAVE+LLGNPG+ Sbjct: 491 LQEMGFFDTQENIRALTATAGNVHAAVERLLGNPGQ 526 >ref|XP_009400382.1| PREDICTED: ubiquitin domain-containing protein DSK2a-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 533 Score = 68.2 bits (165), Expect = 2e-09 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -2 Query: 380 LQEMGFFDTQENIRALIASAGNVHAAVEQLLGNPGR 273 LQEMGFFDTQENIRAL A+AGNVHAAVE+LLGNPG+ Sbjct: 498 LQEMGFFDTQENIRALTATAGNVHAAVERLLGNPGQ 533 >emb|CBI38418.3| unnamed protein product [Vitis vinifera] Length = 295 Score = 68.2 bits (165), Expect = 2e-09 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -2 Query: 380 LQEMGFFDTQENIRALIASAGNVHAAVEQLLGNPGR 273 LQEMGFFDTQENIRAL A+AGNVHAAVE+LLGNPG+ Sbjct: 260 LQEMGFFDTQENIRALTATAGNVHAAVERLLGNPGQ 295 >ref|XP_012837248.1| PREDICTED: ubiquitin domain-containing protein DSK2b-like isoform X1 [Erythranthe guttatus] gi|604333679|gb|EYU38030.1| hypothetical protein MIMGU_mgv1a004076mg [Erythranthe guttata] Length = 545 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/36 (86%), Positives = 36/36 (100%) Frame = -2 Query: 380 LQEMGFFDTQENIRALIASAGNVHAAVEQLLGNPGR 273 LQEMGFFDTQENIRAL+A++GNVHAAVE+LLGNPG+ Sbjct: 510 LQEMGFFDTQENIRALLATSGNVHAAVERLLGNPGQ 545 >ref|XP_010242891.1| PREDICTED: ubiquitin domain-containing protein DSK2a-like isoform X3 [Nelumbo nucifera] Length = 558 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -2 Query: 380 LQEMGFFDTQENIRALIASAGNVHAAVEQLLGNPGR 273 LQEMGFFDTQENIRAL A+AGNVHAAVE+LLGNPG+ Sbjct: 523 LQEMGFFDTQENIRALSATAGNVHAAVERLLGNPGQ 558 >ref|XP_010242888.1| PREDICTED: ubiquitin domain-containing protein DSK2a-like isoform X1 [Nelumbo nucifera] Length = 559 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -2 Query: 380 LQEMGFFDTQENIRALIASAGNVHAAVEQLLGNPGR 273 LQEMGFFDTQENIRAL A+AGNVHAAVE+LLGNPG+ Sbjct: 524 LQEMGFFDTQENIRALSATAGNVHAAVERLLGNPGQ 559 >ref|XP_010266172.1| PREDICTED: ubiquitin domain-containing protein DSK2a-like [Nelumbo nucifera] Length = 554 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -2 Query: 380 LQEMGFFDTQENIRALIASAGNVHAAVEQLLGNPGR 273 LQEMGFFDTQENIRAL A+AGNVHAAVE+LLGNPG+ Sbjct: 519 LQEMGFFDTQENIRALSATAGNVHAAVERLLGNPGQ 554 >emb|CAL07979.1| putative ubiquitin protein 2 [Platanus x acerifolia] Length = 62 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -2 Query: 380 LQEMGFFDTQENIRALIASAGNVHAAVEQLLGNPGR 273 LQEMGFFDTQENIRAL A+AGNVHAAVE+LLGNPG+ Sbjct: 27 LQEMGFFDTQENIRALSATAGNVHAAVERLLGNPGQ 62 >ref|XP_012065449.1| PREDICTED: ubiquitin domain-containing protein DSK2a-like [Jatropha curcas] Length = 692 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -2 Query: 380 LQEMGFFDTQENIRALIASAGNVHAAVEQLLGNPGR 273 LQEMGFFDTQENIRALIA+AGNVHAAVE+LLGN G+ Sbjct: 657 LQEMGFFDTQENIRALIATAGNVHAAVERLLGNSGQ 692 >ref|XP_009766697.1| PREDICTED: ubiquitin domain-containing protein DSK2b-like isoform X3 [Nicotiana sylvestris] Length = 518 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -2 Query: 380 LQEMGFFDTQENIRALIASAGNVHAAVEQLLGNPGR 273 LQEMGFFDTQENIRALIA+AGNVHAAVE+LLGN G+ Sbjct: 483 LQEMGFFDTQENIRALIATAGNVHAAVERLLGNTGQ 518 >ref|XP_009766695.1| PREDICTED: ubiquitin domain-containing protein DSK2b-like isoform X1 [Nicotiana sylvestris] Length = 547 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -2 Query: 380 LQEMGFFDTQENIRALIASAGNVHAAVEQLLGNPGR 273 LQEMGFFDTQENIRALIA+AGNVHAAVE+LLGN G+ Sbjct: 512 LQEMGFFDTQENIRALIATAGNVHAAVERLLGNTGQ 547 >ref|XP_009601932.1| PREDICTED: ubiquitin domain-containing protein DSK2b-like isoform X3 [Nicotiana tomentosiformis] Length = 519 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -2 Query: 380 LQEMGFFDTQENIRALIASAGNVHAAVEQLLGNPGR 273 LQEMGFFDTQENIRALIA+AGNVHAAVE+LLGN G+ Sbjct: 484 LQEMGFFDTQENIRALIATAGNVHAAVERLLGNTGQ 519 >ref|XP_009601930.1| PREDICTED: ubiquitin domain-containing protein DSK2b-like isoform X1 [Nicotiana tomentosiformis] Length = 548 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -2 Query: 380 LQEMGFFDTQENIRALIASAGNVHAAVEQLLGNPGR 273 LQEMGFFDTQENIRALIA+AGNVHAAVE+LLGN G+ Sbjct: 513 LQEMGFFDTQENIRALIATAGNVHAAVERLLGNTGQ 548