BLASTX nr result
ID: Forsythia21_contig00034314
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00034314 (198 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011072881.1| PREDICTED: protein LONGIFOLIA 1 [Sesamum ind... 69 9e-10 emb|CDP18061.1| unnamed protein product [Coffea canephora] 64 4e-08 >ref|XP_011072881.1| PREDICTED: protein LONGIFOLIA 1 [Sesamum indicum] Length = 1093 Score = 69.3 bits (168), Expect = 9e-10 Identities = 33/55 (60%), Positives = 41/55 (74%) Frame = -1 Query: 189 PPEYPSPVSVLDNTVCTDDSPSPVKHVGKTPKGDESIDSDIILNMVEGSSADNFL 25 PPEY SPVSVL N VC DDSPSP+K+VGK K D S+D + N +EGS A++F+ Sbjct: 787 PPEYSSPVSVLANVVCKDDSPSPIKYVGKALKVDVSMDDERDPNALEGSPANSFI 841 >emb|CDP18061.1| unnamed protein product [Coffea canephora] Length = 1081 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/57 (54%), Positives = 41/57 (71%) Frame = -1 Query: 186 PEYPSPVSVLDNTVCTDDSPSPVKHVGKTPKGDESIDSDIILNMVEGSSADNFLLNS 16 PEYPSPVSVLD+ + DDSPSPVK + KT +GDES ++++I N E S D+ N+ Sbjct: 774 PEYPSPVSVLDSAMDMDDSPSPVKRITKTFRGDESHETNVIPNTEECSVVDSLATNA 830