BLASTX nr result
ID: Forsythia21_contig00034161
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00034161 (338 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003855714.1| hypothetical protein MYCGRDRAFT_99007 [Zymos... 59 1e-06 gb|KJY01355.1| phosphatidyl synthase like protein [Zymoseptoria ... 58 3e-06 ref|XP_007679827.1| hypothetical protein BAUCODRAFT_37789 [Baudo... 58 3e-06 >ref|XP_003855714.1| hypothetical protein MYCGRDRAFT_99007 [Zymoseptoria tritici IPO323] gi|339475598|gb|EGP90690.1| hypothetical protein MYCGRDRAFT_99007 [Zymoseptoria tritici IPO323] Length = 478 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = -1 Query: 338 EAVKTAIKKQLGDDFRFEWDSARVNPLLQQGDSGAVAVE 222 EAVKTA+KK+LG DF+FEW+ AR+NPLLQ + AVAVE Sbjct: 440 EAVKTAMKKELGVDFKFEWNDARINPLLQGNGAAAVAVE 478 >gb|KJY01355.1| phosphatidyl synthase like protein [Zymoseptoria brevis] Length = 478 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = -1 Query: 338 EAVKTAIKKQLGDDFRFEWDSARVNPLLQQGDSGAVAVE 222 EAVKTA+KK+LG DF+FEW+ A++NPLLQ + AVAVE Sbjct: 440 EAVKTAMKKELGVDFKFEWNDAKINPLLQGNGAAAVAVE 478 >ref|XP_007679827.1| hypothetical protein BAUCODRAFT_37789 [Baudoinia compniacensis UAMH 10762] gi|449296854|gb|EMC92873.1| hypothetical protein BAUCODRAFT_37789 [Baudoinia compniacensis UAMH 10762] Length = 504 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -1 Query: 338 EAVKTAIKKQLGDDFRFEWDSARVNPLLQQGDSGAVAVE 222 EAVK A+KK+LG +FRFEW VNPLLQ+G + AVAVE Sbjct: 466 EAVKAAVKKELGQEFRFEWKDEHVNPLLQKGTASAVAVE 504