BLASTX nr result
ID: Forsythia21_contig00034159
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00034159 (288 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KKY25095.1| putative 40s ribosomal protein s23 [Phaeomoniella... 82 1e-13 emb|CRG85217.1| 40S ribosomal protein S23 [Talaromyces islandicus] 82 1e-13 dbj|GAM82847.1| hypothetical protein ANO11243_008330 [fungal sp.... 82 1e-13 gb|KIN06638.1| hypothetical protein OIDMADRAFT_17409 [Oidiodendr... 82 1e-13 gb|KHJ35671.1| putative 40s ribosomal protein s23 [Erysiphe neca... 82 1e-13 gb|KFY81664.1| hypothetical protein V500_11201 [Pseudogymnoascus... 82 1e-13 gb|KFY70068.1| hypothetical protein V499_09497 [Pseudogymnoascus... 82 1e-13 gb|KFY62117.1| hypothetical protein V497_02570 [Pseudogymnoascus... 82 1e-13 gb|KFY38003.1| hypothetical protein V494_04555 [Pseudogymnoascus... 82 1e-13 gb|KFY29135.1| hypothetical protein V493_02524 [Pseudogymnoascus... 82 1e-13 gb|KFY16641.1| hypothetical protein V492_01189 [Pseudogymnoascus... 82 1e-13 gb|KFY09345.1| hypothetical protein V491_08243 [Pseudogymnoascus... 82 1e-13 gb|KFX98897.1| hypothetical protein O988_04151 [Pseudogymnoascus... 82 1e-13 gb|KFX92975.1| hypothetical protein V490_05059 [Pseudogymnoascus... 82 1e-13 gb|KEQ59019.1| ribosomal protein S12/S23 [Aureobasidium melanoge... 82 1e-13 gb|KEF61255.1| 40S ribosomal protein S23 [Exophiala aquamarina C... 82 1e-13 ref|XP_002835161.1| 40S ribosomal protein S23 [Tuber melanosporu... 82 1e-13 ref|XP_003013890.1| hypothetical protein ARB_08002 [Arthroderma ... 82 1e-13 gb|EEH16582.1| ribosomal protein S23 (S12) [Paracoccidioides bra... 82 1e-13 ref|XP_002341358.1| 40S ribosomal protein S23 [Talaromyces stipi... 82 1e-13 >gb|KKY25095.1| putative 40s ribosomal protein s23 [Phaeomoniella chlamydospora] Length = 145 Score = 82.0 bits (201), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 119 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS Sbjct: 107 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 145 >emb|CRG85217.1| 40S ribosomal protein S23 [Talaromyces islandicus] Length = 145 Score = 82.0 bits (201), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 119 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS Sbjct: 107 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 145 >dbj|GAM82847.1| hypothetical protein ANO11243_008330 [fungal sp. No.11243] Length = 145 Score = 82.0 bits (201), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 119 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS Sbjct: 107 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 145 >gb|KIN06638.1| hypothetical protein OIDMADRAFT_17409 [Oidiodendron maius Zn] Length = 145 Score = 82.0 bits (201), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 119 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS Sbjct: 107 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 145 >gb|KHJ35671.1| putative 40s ribosomal protein s23 [Erysiphe necator] Length = 145 Score = 82.0 bits (201), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 119 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS Sbjct: 107 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 145 >gb|KFY81664.1| hypothetical protein V500_11201 [Pseudogymnoascus pannorum VKM F-4518 (FW-2643)] Length = 170 Score = 82.0 bits (201), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 119 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS Sbjct: 132 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 170 >gb|KFY70068.1| hypothetical protein V499_09497 [Pseudogymnoascus pannorum VKM F-103] Length = 209 Score = 82.0 bits (201), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 119 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS Sbjct: 171 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 209 >gb|KFY62117.1| hypothetical protein V497_02570 [Pseudogymnoascus pannorum VKM F-4516 (FW-969)] Length = 160 Score = 82.0 bits (201), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 119 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS Sbjct: 122 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 160 >gb|KFY38003.1| hypothetical protein V494_04555 [Pseudogymnoascus pannorum VKM F-4513 (FW-928)] Length = 162 Score = 82.0 bits (201), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 119 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS Sbjct: 124 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 162 >gb|KFY29135.1| hypothetical protein V493_02524 [Pseudogymnoascus pannorum VKM F-4281 (FW-2241)] gi|682458601|gb|KFZ15741.1| hypothetical protein V502_05432 [Pseudogymnoascus pannorum VKM F-4520 (FW-2644)] Length = 170 Score = 82.0 bits (201), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 119 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS Sbjct: 132 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 170 >gb|KFY16641.1| hypothetical protein V492_01189 [Pseudogymnoascus pannorum VKM F-4246] Length = 214 Score = 82.0 bits (201), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 119 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS Sbjct: 176 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 214 >gb|KFY09345.1| hypothetical protein V491_08243 [Pseudogymnoascus pannorum VKM F-3775] gi|682380418|gb|KFY63701.1| hypothetical protein V496_03768 [Pseudogymnoascus pannorum VKM F-4515 (FW-2607)] gi|682425378|gb|KFY93073.1| hypothetical protein V498_04576 [Pseudogymnoascus pannorum VKM F-4517 (FW-2822)] gi|682443077|gb|KFZ04804.1| hypothetical protein V501_08961 [Pseudogymnoascus pannorum VKM F-4519 (FW-2642)] Length = 167 Score = 82.0 bits (201), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 119 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS Sbjct: 129 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 167 >gb|KFX98897.1| hypothetical protein O988_04151 [Pseudogymnoascus pannorum VKM F-3808] Length = 209 Score = 82.0 bits (201), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 119 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS Sbjct: 171 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 209 >gb|KFX92975.1| hypothetical protein V490_05059 [Pseudogymnoascus pannorum VKM F-3557] Length = 209 Score = 82.0 bits (201), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 119 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS Sbjct: 171 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 209 >gb|KEQ59019.1| ribosomal protein S12/S23 [Aureobasidium melanogenum CBS 110374] gi|662517495|gb|KEQ75057.1| ribosomal protein S12/S23 [Aureobasidium namibiae CBS 147.97] gi|662529154|gb|KEQ86530.1| ribosomal protein S12/S23 [Aureobasidium pullulans EXF-150] gi|662536719|gb|KEQ94030.1| hypothetical protein AUEXF2481DRAFT_89842 [Aureobasidium subglaciale EXF-2481] Length = 145 Score = 82.0 bits (201), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 119 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS Sbjct: 107 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 145 >gb|KEF61255.1| 40S ribosomal protein S23 [Exophiala aquamarina CBS 119918] gi|759214092|gb|KIV91432.1| 40S ribosomal protein S23 [Exophiala mesophila] Length = 146 Score = 82.0 bits (201), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 119 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS Sbjct: 108 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 146 >ref|XP_002835161.1| 40S ribosomal protein S23 [Tuber melanosporum Mel28] gi|295627936|emb|CAZ79282.1| unnamed protein product [Tuber melanosporum] Length = 145 Score = 82.0 bits (201), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 119 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS Sbjct: 107 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 145 >ref|XP_003013890.1| hypothetical protein ARB_08002 [Arthroderma benhamiae CBS 112371] gi|302659189|ref|XP_003021288.1| hypothetical protein TRV_04601 [Trichophyton verrucosum HKI 0517] gi|327302234|ref|XP_003235809.1| 40S ribosomal protein S23 [Trichophyton rubrum CBS 118892] gi|291177456|gb|EFE33250.1| hypothetical protein ARB_08002 [Arthroderma benhamiae CBS 112371] gi|291185179|gb|EFE40670.1| hypothetical protein TRV_04601 [Trichophyton verrucosum HKI 0517] gi|326461151|gb|EGD86604.1| 40S ribosomal protein S23 [Trichophyton rubrum CBS 118892] gi|326470019|gb|EGD94028.1| ribosomal protein S12 [Trichophyton tonsurans CBS 112818] gi|326482771|gb|EGE06781.1| 40S ribosomal protein S23 [Trichophyton equinum CBS 127.97] gi|607876764|gb|EZF21940.1| 40S ribosomal protein S23 [Trichophyton rubrum MR850] gi|607898186|gb|EZF36457.1| 40S ribosomal protein S23 [Trichophyton interdigitale H6] gi|607898187|gb|EZF36458.1| 40S ribosomal protein S23 [Trichophyton interdigitale H6] gi|607903507|gb|EZF40990.1| 40S ribosomal protein S23 [Trichophyton rubrum CBS 100081] gi|607915589|gb|EZF51615.1| 40S ribosomal protein S23 [Trichophyton rubrum CBS 288.86] gi|607927659|gb|EZF62241.1| 40S ribosomal protein S23 [Trichophyton rubrum CBS 289.86] gi|607939582|gb|EZF72861.1| 40S ribosomal protein S23 [Trichophyton soudanense CBS 452.61] gi|607951653|gb|EZF83575.1| 40S ribosomal protein S23 [Trichophyton rubrum MR1448] gi|607963771|gb|EZF94228.1| 40S ribosomal protein S23 [Trichophyton rubrum MR1459] gi|607975992|gb|EZG05203.1| 40S ribosomal protein S23 [Trichophyton rubrum CBS 735.88] gi|607987811|gb|EZG15827.1| 40S ribosomal protein S23 [Trichophyton rubrum CBS 202.88] gi|633048083|gb|KDB24479.1| 40S ribosomal protein S23 [Trichophyton interdigitale MR816] gi|633048084|gb|KDB24480.1| 40S ribosomal protein S23 [Trichophyton interdigitale MR816] gi|633057839|gb|KDB32738.1| 40S ribosomal protein S23 [Trichophyton rubrum D6] gi|861303914|gb|KMQ48011.1| Ribosomal protein S23, eukaryotic/archaeal [Trichophyton rubrum] Length = 145 Score = 82.0 bits (201), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 119 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS Sbjct: 107 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 145 >gb|EEH16582.1| ribosomal protein S23 (S12) [Paracoccidioides brasiliensis Pb03] Length = 126 Score = 82.0 bits (201), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 119 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS Sbjct: 88 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 126 >ref|XP_002341358.1| 40S ribosomal protein S23 [Talaromyces stipitatus ATCC 10500] gi|218724554|gb|EED23971.1| ribosomal protein S23 (S12) [Talaromyces stipitatus ATCC 10500] gi|748554422|dbj|GAM39099.1| ribosomal protein [Talaromyces cellulolyticus] Length = 145 Score = 82.0 bits (201), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 119 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS Sbjct: 107 FGRKGKAKGDIPGVRFKVVKVSGVGLSALWKEKKEKPRS 145