BLASTX nr result
ID: Forsythia21_contig00034113
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00034113 (275 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001932895.1| endoglucanase B [Pyrenophora tritici-repenti... 60 7e-07 gb|EUN32562.1| lytic polysaccharide monooxygenase [Bipolaris vic... 57 4e-06 ref|XP_007695291.1| glycoside hydrolase family 61 protein [Bipol... 57 4e-06 ref|XP_003301611.1| hypothetical protein PTT_13147 [Pyrenophora ... 57 5e-06 >ref|XP_001932895.1| endoglucanase B [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187978459|gb|EDU45085.1| endoglucanase B [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 338 Score = 59.7 bits (143), Expect = 7e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -2 Query: 274 DMTKACKATDPGVLFNIYGGATEYTVPGPKVW 179 DMTKA KATDPGV F+IY G T+YT+PGPKVW Sbjct: 198 DMTKAYKATDPGVKFDIYSGKTDYTIPGPKVW 229 >gb|EUN32562.1| lytic polysaccharide monooxygenase [Bipolaris victoriae FI3] Length = 316 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -2 Query: 274 DMTKACKATDPGVLFNIYGGATEYTVPGPKVWD 176 DMTKA KATDPGV F+IY T YTVPGP+VWD Sbjct: 198 DMTKAYKATDPGVKFDIYNSFTSYTVPGPQVWD 230 >ref|XP_007695291.1| glycoside hydrolase family 61 protein [Bipolaris sorokiniana ND90Pr] gi|451856880|gb|EMD70171.1| glycoside hydrolase family 61 protein [Bipolaris sorokiniana ND90Pr] Length = 317 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -2 Query: 274 DMTKACKATDPGVLFNIYGGATEYTVPGPKVWD 176 DMTKA KATDPGV F+IY + YTVPGPKVWD Sbjct: 198 DMTKAYKATDPGVKFDIYNAFSSYTVPGPKVWD 230 >ref|XP_003301611.1| hypothetical protein PTT_13147 [Pyrenophora teres f. teres 0-1] gi|311323485|gb|EFQ90284.1| hypothetical protein PTT_13147 [Pyrenophora teres f. teres 0-1] Length = 351 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -2 Query: 274 DMTKACKATDPGVLFNIYGGATEYTVPGPKVW 179 DMTKA ATDPGV F+IY G T YT+PGPKVW Sbjct: 198 DMTKAYSATDPGVKFDIYSGKTSYTIPGPKVW 229