BLASTX nr result
ID: Forsythia21_contig00033986
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00033986 (234 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIV91053.1| hypothetical protein PV10_05638 [Exophiala mesoph... 87 4e-15 gb|KIX10612.1| hypothetical protein Z518_01696 [Rhinocladiella m... 84 4e-14 gb|KIW75623.1| hypothetical protein Z517_10365 [Fonsecaea pedros... 84 4e-14 gb|KKY25472.1| putative elongation factor 1-gamma [Phaeomoniella... 84 5e-14 gb|KIV85484.1| hypothetical protein PV11_01176 [Exophiala sideris] 84 5e-14 gb|AIL25493.1| EF1Bgamma1 [Exophiala pisciphila] 84 5e-14 gb|KIW26889.1| hypothetical protein PV07_06682 [Cladophialophora... 83 6e-14 ref|XP_007755740.1| elongation factor 1-gamma [Cladophialophora ... 83 8e-14 ref|XP_008716958.1| hypothetical protein HMPREF1541_04390 [Cyphe... 83 8e-14 ref|XP_008727405.1| hypothetical protein G647_04846 [Cladophialo... 83 8e-14 ref|XP_001793018.1| hypothetical protein SNOG_02412 [Phaeosphaer... 83 8e-14 dbj|GAM90792.1| hypothetical protein ANO11243_088370 [fungal sp.... 82 1e-13 gb|EMD94788.1| hypothetical protein COCHEDRAFT_1128600 [Bipolari... 82 1e-13 gb|KIX93645.1| hypothetical protein Z520_10551 [Fonsecaea multim... 82 1e-13 gb|KIW71582.1| hypothetical protein PV04_03729 [Capronia semiimm... 82 1e-13 ref|XP_007743206.1| elongation factor 1-gamma [Cladophialophora ... 82 1e-13 ref|XP_007777470.1| elongation factor EF-1 gamma subunit [Conios... 82 1e-13 gb|KKY13466.1| putative elongation factor 1-gamma [Diplodia seri... 82 2e-13 gb|KIW57420.1| hypothetical protein PV05_05970 [Exophiala xenobi... 82 2e-13 gb|KIW37511.1| hypothetical protein PV06_10164 [Exophiala oligos... 82 2e-13 >gb|KIV91053.1| hypothetical protein PV10_05638 [Exophiala mesophila] Length = 414 Score = 87.0 bits (214), Expect = 4e-15 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 233 TKLDPTKAEDKEFVNDQWSWDKPIEVNGKTYEWADGKVFK 114 TKLDPTKAEDKEFVNDQWSWDKPI V GKTYEWADGKVFK Sbjct: 375 TKLDPTKAEDKEFVNDQWSWDKPIVVGGKTYEWADGKVFK 414 >gb|KIX10612.1| hypothetical protein Z518_01696 [Rhinocladiella mackenziei CBS 650.93] Length = 411 Score = 84.0 bits (206), Expect = 4e-14 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -2 Query: 233 TKLDPTKAEDKEFVNDQWSWDKPIEVNGKTYEWADGKVFK 114 TKLDP+K EDK FV DQWSWDKPIEVNGKTYEWADGKVFK Sbjct: 372 TKLDPSKPEDKAFVEDQWSWDKPIEVNGKTYEWADGKVFK 411 >gb|KIW75623.1| hypothetical protein Z517_10365 [Fonsecaea pedrosoi CBS 271.37] Length = 414 Score = 84.0 bits (206), Expect = 4e-14 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -2 Query: 233 TKLDPTKAEDKEFVNDQWSWDKPIEVNGKTYEWADGKVFK 114 TKLDP+K EDK FV DQWSWDKPIEVNGKTYEWADGKVFK Sbjct: 375 TKLDPSKPEDKAFVEDQWSWDKPIEVNGKTYEWADGKVFK 414 >gb|KKY25472.1| putative elongation factor 1-gamma [Phaeomoniella chlamydospora] Length = 410 Score = 83.6 bits (205), Expect = 5e-14 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -2 Query: 233 TKLDPTKAEDKEFVNDQWSWDKPIEVNGKTYEWADGKVFK 114 TKLDP+K ED+EFVNDQW+WDKP+ VNGKTYEWADGKVFK Sbjct: 371 TKLDPSKPEDREFVNDQWAWDKPVTVNGKTYEWADGKVFK 410 >gb|KIV85484.1| hypothetical protein PV11_01176 [Exophiala sideris] Length = 416 Score = 83.6 bits (205), Expect = 5e-14 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -2 Query: 233 TKLDPTKAEDKEFVNDQWSWDKPIEVNGKTYEWADGKVFK 114 TKLDP+KAEDK FV DQWSWDKPIEVNGK YEWADGKVFK Sbjct: 377 TKLDPSKAEDKAFVEDQWSWDKPIEVNGKKYEWADGKVFK 416 >gb|AIL25493.1| EF1Bgamma1 [Exophiala pisciphila] Length = 415 Score = 83.6 bits (205), Expect = 5e-14 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -2 Query: 233 TKLDPTKAEDKEFVNDQWSWDKPIEVNGKTYEWADGKVFK 114 TKLDP+KAEDK FV DQWSWDKPI VNGKTYEWADGKVFK Sbjct: 376 TKLDPSKAEDKAFVEDQWSWDKPITVNGKTYEWADGKVFK 415 >gb|KIW26889.1| hypothetical protein PV07_06682 [Cladophialophora immunda] Length = 416 Score = 83.2 bits (204), Expect = 6e-14 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -2 Query: 233 TKLDPTKAEDKEFVNDQWSWDKPIEVNGKTYEWADGKVFK 114 TKLDP+K EDKEF+ +QWSWDKPIEVNGKTYEWADGKVFK Sbjct: 377 TKLDPSKPEDKEFLENQWSWDKPIEVNGKTYEWADGKVFK 416 >ref|XP_007755740.1| elongation factor 1-gamma [Cladophialophora yegresii CBS 114405] gi|589979816|gb|EXJ63086.1| elongation factor 1-gamma [Cladophialophora yegresii CBS 114405] Length = 416 Score = 82.8 bits (203), Expect = 8e-14 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -2 Query: 233 TKLDPTKAEDKEFVNDQWSWDKPIEVNGKTYEWADGKVFK 114 TKLDP+K EDK+FV DQWSWDKPI VNGKTYEWADGKVFK Sbjct: 377 TKLDPSKPEDKQFVEDQWSWDKPITVNGKTYEWADGKVFK 416 >ref|XP_008716958.1| hypothetical protein HMPREF1541_04390 [Cyphellophora europaea CBS 101466] gi|568117499|gb|ETN40115.1| hypothetical protein HMPREF1541_04390 [Cyphellophora europaea CBS 101466] Length = 411 Score = 82.8 bits (203), Expect = 8e-14 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -2 Query: 233 TKLDPTKAEDKEFVNDQWSWDKPIEVNGKTYEWADGKVFK 114 TKLDP+K EDK FV D+WSWDKPIEVNGKTYEWADGKVFK Sbjct: 372 TKLDPSKPEDKAFVEDEWSWDKPIEVNGKTYEWADGKVFK 411 >ref|XP_008727405.1| hypothetical protein G647_04846 [Cladophialophora carrionii CBS 160.54] gi|565933796|gb|ETI23050.1| hypothetical protein G647_04846 [Cladophialophora carrionii CBS 160.54] Length = 412 Score = 82.8 bits (203), Expect = 8e-14 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -2 Query: 233 TKLDPTKAEDKEFVNDQWSWDKPIEVNGKTYEWADGKVFK 114 TKLDP+K ED+EFV DQWSWDKPI VNGKTYEWADGKVFK Sbjct: 373 TKLDPSKPEDREFVEDQWSWDKPITVNGKTYEWADGKVFK 412 >ref|XP_001793018.1| hypothetical protein SNOG_02412 [Phaeosphaeria nodorum SN15] gi|111069504|gb|EAT90624.1| hypothetical protein SNOG_02412 [Phaeosphaeria nodorum SN15] Length = 414 Score = 82.8 bits (203), Expect = 8e-14 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -2 Query: 233 TKLDPTKAEDKEFVNDQWSWDKPIEVNGKTYEWADGKVFK 114 TKLDPTKAEDKEFVNDQWSWDKPI V+GK Y WADGKVFK Sbjct: 375 TKLDPTKAEDKEFVNDQWSWDKPIVVDGKEYPWADGKVFK 414 >dbj|GAM90792.1| hypothetical protein ANO11243_088370 [fungal sp. No.11243] Length = 414 Score = 82.4 bits (202), Expect = 1e-13 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -2 Query: 233 TKLDPTKAEDKEFVNDQWSWDKPIEVNGKTYEWADGKVFK 114 TKLDP K+EDKEFV+D W+WDKPI+VNGKTYEWADGKVFK Sbjct: 375 TKLDPKKSEDKEFVDDMWAWDKPIDVNGKTYEWADGKVFK 414 >gb|EMD94788.1| hypothetical protein COCHEDRAFT_1128600 [Bipolaris maydis C5] Length = 413 Score = 82.4 bits (202), Expect = 1e-13 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -2 Query: 233 TKLDPTKAEDKEFVNDQWSWDKPIEVNGKTYEWADGKVFK 114 TKLDPTK ED+EFVNDQW+WDKPI VNGKT EWADGKVFK Sbjct: 374 TKLDPTKEEDREFVNDQWAWDKPITVNGKTMEWADGKVFK 413 >gb|KIX93645.1| hypothetical protein Z520_10551 [Fonsecaea multimorphosa CBS 102226] Length = 416 Score = 82.0 bits (201), Expect = 1e-13 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -2 Query: 233 TKLDPTKAEDKEFVNDQWSWDKPIEVNGKTYEWADGKVFK 114 TKLDP+K EDKEF+ +QW+WDKPIEVNGKTYEWADGKVFK Sbjct: 377 TKLDPSKPEDKEFLENQWAWDKPIEVNGKTYEWADGKVFK 416 >gb|KIW71582.1| hypothetical protein PV04_03729 [Capronia semiimmersa] Length = 415 Score = 82.0 bits (201), Expect = 1e-13 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -2 Query: 233 TKLDPTKAEDKEFVNDQWSWDKPIEVNGKTYEWADGKVFK 114 TKLDP+K EDKEFV DQWSWDKPI V+GKTYEWADGKVFK Sbjct: 376 TKLDPSKPEDKEFVEDQWSWDKPITVDGKTYEWADGKVFK 415 >ref|XP_007743206.1| elongation factor 1-gamma [Cladophialophora psammophila CBS 110553] gi|589989150|gb|EXJ71908.1| elongation factor 1-gamma [Cladophialophora psammophila CBS 110553] Length = 417 Score = 82.0 bits (201), Expect = 1e-13 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -2 Query: 233 TKLDPTKAEDKEFVNDQWSWDKPIEVNGKTYEWADGKVFK 114 TKLDP+K EDKEF+ +QW+WDKPIEVNGKTYEWADGKVFK Sbjct: 378 TKLDPSKPEDKEFLENQWAWDKPIEVNGKTYEWADGKVFK 417 >ref|XP_007777470.1| elongation factor EF-1 gamma subunit [Coniosporium apollinis CBS 100218] gi|494824935|gb|EON62153.1| elongation factor EF-1 gamma subunit [Coniosporium apollinis CBS 100218] Length = 418 Score = 82.0 bits (201), Expect = 1e-13 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -2 Query: 233 TKLDPTKAEDKEFVNDQWSWDKPIEVNGKTYEWADGKVFK 114 TKLDP+K EDK FV D WSWDKPIEVNGKTYEWADGKVFK Sbjct: 379 TKLDPSKPEDKAFVEDMWSWDKPIEVNGKTYEWADGKVFK 418 >gb|KKY13466.1| putative elongation factor 1-gamma [Diplodia seriata] Length = 411 Score = 81.6 bits (200), Expect = 2e-13 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -2 Query: 233 TKLDPTKAEDKEFVNDQWSWDKPIEVNGKTYEWADGKVFK 114 TKLD TKAEDK FV DQWSWDKP+EVNGK+YEWADGKVFK Sbjct: 372 TKLDHTKAEDKAFVEDQWSWDKPLEVNGKSYEWADGKVFK 411 >gb|KIW57420.1| hypothetical protein PV05_05970 [Exophiala xenobiotica] Length = 416 Score = 81.6 bits (200), Expect = 2e-13 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -2 Query: 233 TKLDPTKAEDKEFVNDQWSWDKPIEVNGKTYEWADGKVFK 114 TKLDP+K EDK FV DQWSWDKPIEVNGK YEWADGKVFK Sbjct: 377 TKLDPSKPEDKAFVEDQWSWDKPIEVNGKKYEWADGKVFK 416 >gb|KIW37511.1| hypothetical protein PV06_10164 [Exophiala oligosperma] Length = 411 Score = 81.6 bits (200), Expect = 2e-13 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -2 Query: 233 TKLDPTKAEDKEFVNDQWSWDKPIEVNGKTYEWADGKVFK 114 TKLDP+K EDK FV DQWSWDKPIEVNGK YEWADGKVFK Sbjct: 372 TKLDPSKPEDKAFVEDQWSWDKPIEVNGKKYEWADGKVFK 411