BLASTX nr result
ID: Forsythia21_contig00033700
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00033700 (345 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007680867.1| hypothetical protein BAUCODRAFT_38635 [Baudo... 63 7e-08 >ref|XP_007680867.1| hypothetical protein BAUCODRAFT_38635 [Baudoinia compniacensis UAMH 10762] gi|449295504|gb|EMC91525.1| hypothetical protein BAUCODRAFT_38635 [Baudoinia compniacensis UAMH 10762] Length = 440 Score = 63.2 bits (152), Expect = 7e-08 Identities = 31/65 (47%), Positives = 37/65 (56%) Frame = -2 Query: 197 YRPTSQALGQVPSIIPDVPVNAIXXXXXXXXXXXXXXXLKYNGRHGKKFGINGMIFGFCV 18 Y P QALGQ P+I+PD P+ A+ LKYN GKKF I GM+FGFC Sbjct: 19 YPPQEQALGQTPTILPDAPICAVFLFLFILSGAGHMFLLKYNAHKGKKFIICGMLFGFCF 78 Query: 17 TRVLA 3 TR+ A Sbjct: 79 TRIFA 83