BLASTX nr result
ID: Forsythia21_contig00033549
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00033549 (705 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEK71799.1| hypothetical chloroplast RF2 [Erythrospermum phyt... 42 2e-07 ref|YP_009108471.1| Ycf2 (chloroplast) [Genlisea margaretae] gi|... 42 2e-07 gb|EPS74500.1| hypothetical protein M569_00217, partial [Genlise... 42 2e-07 gb|ADD30883.1| putative RF2 protein (chloroplast) [Ilex cornuta]... 43 2e-07 gb|ADD30891.1| putative RF2 protein (chloroplast) [Cornus florid... 42 4e-07 ref|YP_009002306.1| Ycf2 (chloroplast) [Pinguicula ehlersiae] gi... 42 5e-07 ref|YP_009002298.1| Ycf2 (chloroplast) [Pinguicula ehlersiae] gi... 42 5e-07 gb|AIW05986.1| hypothetical chloroplast protein [Wrightia natale... 42 6e-07 ref|XP_004240397.1| PREDICTED: uncharacterized protein LOC101264... 61 7e-07 ref|YP_009117265.1| hypothetical chloroplast RF21 (chloroplast) ... 42 8e-07 ref|NP_783294.1| Ycf2 [Atropa belladonna] gi|47117596|sp|Q8S8U1.... 42 8e-07 ref|NP_783274.1| Ycf2 [Atropa belladonna] gi|47117597|sp|Q8S8V2.... 42 8e-07 ref|YP_009144690.1| hypothetical chloroplast RF2 (chloroplast) [... 42 8e-07 ref|YP_008577026.1| Ycf2 (chloroplast) [Eucalyptus spathulata] g... 42 8e-07 ref|YP_009122906.1| hypothetical chloroplast RF21 (chloroplast) ... 42 8e-07 ref|YP_007353958.1| Ycf2 protein (chloroplast) [Tectona grandis]... 42 8e-07 ref|YP_006666073.1| hypothetical protein RF2 (chloroplast) [Caps... 42 8e-07 gb|ADD30882.1| putative RF2 protein (chloroplast) [Ehretia acumi... 42 8e-07 ref|YP_009115939.1| hypothetical chloroplast RF2 [Scrophularia t... 42 8e-07 ref|YP_817526.1| hypothetical chloroplast RF2 [Coffea arabica] g... 42 8e-07 >gb|AEK71799.1| hypothetical chloroplast RF2 [Erythrospermum phytolaccoides] Length = 2302 Score = 42.0 bits (97), Expect(2) = 2e-07 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +2 Query: 572 QTRRPRSIHKRWFIKNTQGKHFRLPDCRKR 661 QT P SI+KRWFIKNTQ KHF L R+R Sbjct: 2214 QTDPPTSIYKRWFIKNTQEKHFELLIHRQR 2243 Score = 40.8 bits (94), Expect(2) = 2e-07 Identities = 21/32 (65%), Positives = 26/32 (81%), Gaps = 3/32 (9%) Frame = +3 Query: 489 FFISKD---LSVFSHRELFAHEKISKRLLTSK 575 FF+ KD +SVFSHRE FA E++SKRLLTS+ Sbjct: 2183 FFLFKDQPLVSVFSHREFFADEEMSKRLLTSQ 2214 >ref|YP_009108471.1| Ycf2 (chloroplast) [Genlisea margaretae] gi|723456783|ref|YP_009108475.1| Ycf2 (chloroplast) [Genlisea margaretae] gi|702068555|emb|CDI44031.1| Ycf2 (chloroplast) [Genlisea margaretae] gi|702068559|emb|CDI44038.1| Ycf2 (chloroplast) [Genlisea margaretae] Length = 2279 Score = 42.0 bits (97), Expect(2) = 2e-07 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +2 Query: 572 QTRRPRSIHKRWFIKNTQGKHFRLPDCRKR 661 QT P SI+KRWFIKNTQ KHF L R+R Sbjct: 2177 QTDPPTSIYKRWFIKNTQEKHFELLINRQR 2206 Score = 40.8 bits (94), Expect(2) = 2e-07 Identities = 22/33 (66%), Positives = 27/33 (81%), Gaps = 3/33 (9%) Frame = +3 Query: 486 SFFISKDL---SVFSHRELFAHEKISKRLLTSK 575 SFF+ KD SVFSHRELFA+E++SK LLTS+ Sbjct: 2145 SFFLFKDQPPDSVFSHRELFANEEMSKGLLTSQ 2177 >gb|EPS74500.1| hypothetical protein M569_00217, partial [Genlisea aurea] Length = 2262 Score = 42.0 bits (97), Expect(2) = 2e-07 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +2 Query: 572 QTRRPRSIHKRWFIKNTQGKHFRLPDCRKR 661 QT P SI+KRWFIKNTQ KHF L R+R Sbjct: 2174 QTDPPTSIYKRWFIKNTQEKHFELLINRQR 2203 Score = 40.8 bits (94), Expect(2) = 2e-07 Identities = 22/33 (66%), Positives = 27/33 (81%), Gaps = 3/33 (9%) Frame = +3 Query: 486 SFFISKDL---SVFSHRELFAHEKISKRLLTSK 575 SFF+ KD SVFSHRELFA+E++SK LLTS+ Sbjct: 2142 SFFLFKDQPPDSVFSHRELFANEEMSKGLLTSQ 2174 >gb|ADD30883.1| putative RF2 protein (chloroplast) [Ilex cornuta] gi|340806994|gb|AEK71615.1| hypothetical chloroplast RF2 [Ilex cornuta] Length = 2297 Score = 42.7 bits (99), Expect(2) = 2e-07 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = +2 Query: 572 QTRRPRSIHKRWFIKNTQGKHFRLPDCRKR 661 QT P SI+KRWFIKNTQ KHF+L R+R Sbjct: 2209 QTDPPTSIYKRWFIKNTQEKHFKLLINRQR 2238 Score = 39.7 bits (91), Expect(2) = 2e-07 Identities = 21/32 (65%), Positives = 26/32 (81%), Gaps = 3/32 (9%) Frame = +3 Query: 489 FFISKD---LSVFSHRELFAHEKISKRLLTSK 575 FF+ KD +SVFSHRELFA E++SK LLTS+ Sbjct: 2178 FFLFKDQPFVSVFSHRELFADEEMSKGLLTSQ 2209 >gb|ADD30891.1| putative RF2 protein (chloroplast) [Cornus florida] gi|340807086|gb|AEK71690.1| hypothetical chloroplast RF2 [Cornus florida] Length = 2295 Score = 42.0 bits (97), Expect(2) = 4e-07 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +2 Query: 572 QTRRPRSIHKRWFIKNTQGKHFRLPDCRKR 661 QT P SI+KRWFIKNTQ KHF L R+R Sbjct: 2207 QTDPPTSIYKRWFIKNTQEKHFELLINRQR 2236 Score = 39.7 bits (91), Expect(2) = 4e-07 Identities = 21/32 (65%), Positives = 26/32 (81%), Gaps = 3/32 (9%) Frame = +3 Query: 489 FFISKD---LSVFSHRELFAHEKISKRLLTSK 575 FF+ KD +SVFSHRELFA E++SK LLTS+ Sbjct: 2176 FFLFKDRPFVSVFSHRELFADEEMSKGLLTSQ 2207 >ref|YP_009002306.1| Ycf2 (chloroplast) [Pinguicula ehlersiae] gi|575882189|emb|CDL78862.1| Ycf2 (chloroplast) [Pinguicula ehlersiae] Length = 2280 Score = 42.0 bits (97), Expect(2) = 5e-07 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +2 Query: 572 QTRRPRSIHKRWFIKNTQGKHFRLPDCRKR 661 QT P SI+KRWFIKNTQ KHF L R+R Sbjct: 2178 QTDPPTSIYKRWFIKNTQEKHFELLINRQR 2207 Score = 39.3 bits (90), Expect(2) = 5e-07 Identities = 21/32 (65%), Positives = 26/32 (81%), Gaps = 3/32 (9%) Frame = +3 Query: 489 FFISKDL---SVFSHRELFAHEKISKRLLTSK 575 FF+ KD SVFSHRELFA+E++SK LLTS+ Sbjct: 2147 FFLFKDQPPDSVFSHRELFANEEMSKGLLTSQ 2178 >ref|YP_009002298.1| Ycf2 (chloroplast) [Pinguicula ehlersiae] gi|575882181|emb|CDL78854.1| Ycf2 (chloroplast) [Pinguicula ehlersiae] Length = 2280 Score = 42.0 bits (97), Expect(2) = 5e-07 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +2 Query: 572 QTRRPRSIHKRWFIKNTQGKHFRLPDCRKR 661 QT P SI+KRWFIKNTQ KHF L R+R Sbjct: 2178 QTDPPTSIYKRWFIKNTQEKHFELLINRQR 2207 Score = 39.3 bits (90), Expect(2) = 5e-07 Identities = 21/32 (65%), Positives = 26/32 (81%), Gaps = 3/32 (9%) Frame = +3 Query: 489 FFISKDL---SVFSHRELFAHEKISKRLLTSK 575 FF+ KD SVFSHRELFA+E++SK LLTS+ Sbjct: 2147 FFLFKDQPPDSVFSHRELFANEEMSKGLLTSQ 2178 >gb|AIW05986.1| hypothetical chloroplast protein [Wrightia natalensis] gi|702076126|gb|AIW06003.1| hypothetical chloroplast protein [Wrightia natalensis] Length = 2279 Score = 42.0 bits (97), Expect(2) = 6e-07 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +2 Query: 572 QTRRPRSIHKRWFIKNTQGKHFRLPDCRKR 661 QT P SI+KRWFIKNTQ KHF L R+R Sbjct: 2191 QTDPPTSIYKRWFIKNTQEKHFELLINRQR 2220 Score = 38.9 bits (89), Expect(2) = 6e-07 Identities = 21/32 (65%), Positives = 25/32 (78%), Gaps = 3/32 (9%) Frame = +3 Query: 489 FFISKDL---SVFSHRELFAHEKISKRLLTSK 575 FF+ KD SVFSHRELFA E++SK LLTS+ Sbjct: 2160 FFLFKDQPPGSVFSHRELFAEEEMSKGLLTSQ 2191 >ref|XP_004240397.1| PREDICTED: uncharacterized protein LOC101264428 [Solanum lycopersicum] Length = 169 Score = 60.8 bits (146), Expect = 7e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 96 QKLVYNGSKAADEFMETEYYSDLNCIDKQHH 4 QKLVYNGS+ +EF+ETEYY DLNCIDKQHH Sbjct: 80 QKLVYNGSQVTEEFIETEYYKDLNCIDKQHH 110 >ref|YP_009117265.1| hypothetical chloroplast RF21 (chloroplast) [Premna microphylla] gi|752789850|ref|YP_009117284.1| hypothetical chloroplast RF21 (chloroplast) [Premna microphylla] gi|748013949|gb|AJE28419.1| hypothetical chloroplast RF21 (chloroplast) [Premna microphylla] gi|748013968|gb|AJE28438.1| hypothetical chloroplast RF21 (chloroplast) [Premna microphylla] Length = 2296 Score = 42.0 bits (97), Expect(2) = 8e-07 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +2 Query: 572 QTRRPRSIHKRWFIKNTQGKHFRLPDCRKR 661 QT P SI+KRWFIKNTQ KHF L R+R Sbjct: 2208 QTDPPTSIYKRWFIKNTQEKHFELLINRQR 2237 Score = 38.5 bits (88), Expect(2) = 8e-07 Identities = 21/32 (65%), Positives = 25/32 (78%), Gaps = 3/32 (9%) Frame = +3 Query: 489 FFISKDL---SVFSHRELFAHEKISKRLLTSK 575 FF+ KD SVFSHRELFA E++SK LLTS+ Sbjct: 2177 FFLFKDQPPGSVFSHRELFADEEMSKGLLTSQ 2208 >ref|NP_783294.1| Ycf2 [Atropa belladonna] gi|47117596|sp|Q8S8U1.1|YCF2B_ATRBE RecName: Full=Protein Ycf2 B (chloroplast) [Atropa belladonna] gi|20068395|emb|CAC88108.1| ycf2 protein [Atropa belladonna] Length = 2291 Score = 42.0 bits (97), Expect(2) = 8e-07 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +2 Query: 572 QTRRPRSIHKRWFIKNTQGKHFRLPDCRKR 661 QT P SI+KRWFIKNTQ KHF L R+R Sbjct: 2203 QTDPPTSIYKRWFIKNTQEKHFELLINRQR 2232 Score = 38.5 bits (88), Expect(2) = 8e-07 Identities = 21/32 (65%), Positives = 25/32 (78%), Gaps = 3/32 (9%) Frame = +3 Query: 489 FFISKDL---SVFSHRELFAHEKISKRLLTSK 575 FF+ KD SVFSHRELFA E++SK LLTS+ Sbjct: 2172 FFLFKDQPPGSVFSHRELFADEEMSKGLLTSQ 2203 >ref|NP_783274.1| Ycf2 [Atropa belladonna] gi|47117597|sp|Q8S8V2.1|YCF2A_ATRBE RecName: Full=Protein Ycf2 A (chloroplast) [Atropa belladonna] gi|20068374|emb|CAC88087.1| ycf2 protein [Atropa belladonna] Length = 2291 Score = 42.0 bits (97), Expect(2) = 8e-07 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +2 Query: 572 QTRRPRSIHKRWFIKNTQGKHFRLPDCRKR 661 QT P SI+KRWFIKNTQ KHF L R+R Sbjct: 2203 QTDPPTSIYKRWFIKNTQEKHFELLINRQR 2232 Score = 38.5 bits (88), Expect(2) = 8e-07 Identities = 21/32 (65%), Positives = 25/32 (78%), Gaps = 3/32 (9%) Frame = +3 Query: 489 FFISKDL---SVFSHRELFAHEKISKRLLTSK 575 FF+ KD SVFSHRELFA E++SK LLTS+ Sbjct: 2172 FFLFKDQPPGSVFSHRELFADEEMSKGLLTSQ 2203 >ref|YP_009144690.1| hypothetical chloroplast RF2 (chloroplast) [Scutellaria baicalensis] gi|836643486|ref|YP_009144671.1| hypothetical chloroplast RF2 (chloroplast) [Scutellaria baicalensis] gi|827345826|gb|AKJ77127.1| hypothetical chloroplast RF2 (chloroplast) [Scutellaria baicalensis] gi|827345827|gb|AKJ77128.1| hypothetical chloroplast RF2 (chloroplast) [Scutellaria baicalensis] Length = 2289 Score = 42.0 bits (97), Expect(2) = 8e-07 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +2 Query: 572 QTRRPRSIHKRWFIKNTQGKHFRLPDCRKR 661 QT P SI+KRWFIKNTQ KHF L R+R Sbjct: 2201 QTDPPTSIYKRWFIKNTQEKHFELLINRQR 2230 Score = 38.5 bits (88), Expect(2) = 8e-07 Identities = 21/32 (65%), Positives = 25/32 (78%), Gaps = 3/32 (9%) Frame = +3 Query: 489 FFISKDL---SVFSHRELFAHEKISKRLLTSK 575 FF+ KD SVFSHRELFA E++SK LLTS+ Sbjct: 2170 FFLFKDQPPGSVFSHRELFADEEMSKGLLTSQ 2201 >ref|YP_008577026.1| Ycf2 (chloroplast) [Eucalyptus spathulata] gi|545718199|ref|YP_008577045.1| Ycf2 (chloroplast) [Eucalyptus spathulata] gi|442568260|gb|AGC58435.1| Ycf2 (chloroplast) [Eucalyptus spathulata] gi|442568279|gb|AGC58454.1| Ycf2 (chloroplast) [Eucalyptus spathulata] Length = 2287 Score = 42.4 bits (98), Expect(2) = 8e-07 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +2 Query: 572 QTRRPRSIHKRWFIKNTQGKHFRLPDCRKR 661 QT P SI+KRWFIKNTQ KHF L R+R Sbjct: 2192 QTDSPTSIYKRWFIKNTQEKHFELLIHRQR 2221 Score = 38.1 bits (87), Expect(2) = 8e-07 Identities = 20/32 (62%), Positives = 25/32 (78%), Gaps = 3/32 (9%) Frame = +3 Query: 489 FFISKD---LSVFSHRELFAHEKISKRLLTSK 575 FF+ KD +SVFSHRE FA E++SK LLTS+ Sbjct: 2161 FFLFKDQPFVSVFSHREFFADEEMSKGLLTSQ 2192 >ref|YP_009122906.1| hypothetical chloroplast RF21 (chloroplast) [Capsicum lycianthoides] gi|814071845|ref|YP_009122924.1| hypothetical chloroplast RF21 (chloroplast) [Capsicum lycianthoides] gi|756141208|gb|AJK90789.1| hypothetical chloroplast RF21 (chloroplast) [Capsicum lycianthoides] gi|756141226|gb|AJK90807.1| hypothetical chloroplast RF21 (chloroplast) [Capsicum lycianthoides] Length = 2287 Score = 42.0 bits (97), Expect(2) = 8e-07 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +2 Query: 572 QTRRPRSIHKRWFIKNTQGKHFRLPDCRKR 661 QT P SI+KRWFIKNTQ KHF L R+R Sbjct: 2199 QTDPPTSIYKRWFIKNTQEKHFELLINRQR 2228 Score = 38.5 bits (88), Expect(2) = 8e-07 Identities = 21/32 (65%), Positives = 25/32 (78%), Gaps = 3/32 (9%) Frame = +3 Query: 489 FFISKDL---SVFSHRELFAHEKISKRLLTSK 575 FF+ KD SVFSHRELFA E++SK LLTS+ Sbjct: 2168 FFLFKDQPPGSVFSHRELFADEEMSKGLLTSQ 2199 >ref|YP_007353958.1| Ycf2 protein (chloroplast) [Tectona grandis] gi|442743025|ref|YP_007353977.1| Ycf2 protein (chloroplast) [Tectona grandis] gi|438687647|emb|CCP47174.1| YCF2 protein (chloroplast) [Tectona grandis] gi|438687666|emb|CCP47196.1| ycf2 protein (chloroplast) [Tectona grandis] gi|438688331|emb|CCP47263.1| YCF2 protein (chloroplast) [Tectona grandis] gi|438688350|emb|CCP47285.1| ycf2 protein (chloroplast) [Tectona grandis] gi|438688455|emb|CCP47352.1| YCF2 protein (chloroplast) [Tectona grandis] gi|438688474|emb|CCP47374.1| ycf2 protein (chloroplast) [Tectona grandis] Length = 2287 Score = 42.0 bits (97), Expect(2) = 8e-07 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +2 Query: 572 QTRRPRSIHKRWFIKNTQGKHFRLPDCRKR 661 QT P SI+KRWFIKNTQ KHF L R+R Sbjct: 2199 QTDPPTSIYKRWFIKNTQEKHFELLINRQR 2228 Score = 38.5 bits (88), Expect(2) = 8e-07 Identities = 21/32 (65%), Positives = 25/32 (78%), Gaps = 3/32 (9%) Frame = +3 Query: 489 FFISKDL---SVFSHRELFAHEKISKRLLTSK 575 FF+ KD SVFSHRELFA E++SK LLTS+ Sbjct: 2168 FFLFKDQPPGSVFSHRELFADEEMSKGLLTSQ 2199 >ref|YP_006666073.1| hypothetical protein RF2 (chloroplast) [Capsicum annuum] gi|404474587|ref|YP_006666092.1| hypothetical protein RF2 (chloroplast) [Capsicum annuum] gi|401065975|gb|AFP90819.1| hypothetical protein RF2 (chloroplast) [Capsicum annuum] gi|401065994|gb|AFP90838.1| hypothetical protein RF2 (chloroplast) [Capsicum annuum] gi|641803852|gb|AIA77003.1| hypothetical chloroplast RF21 (chloroplast) (chloroplast) [Capsicum annuum var. glabriusculum] gi|641803872|gb|AIA77023.1| hypothetical chloroplast RF21 (chloroplast) (chloroplast) [Capsicum annuum var. glabriusculum] Length = 2286 Score = 42.0 bits (97), Expect(2) = 8e-07 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +2 Query: 572 QTRRPRSIHKRWFIKNTQGKHFRLPDCRKR 661 QT P SI+KRWFIKNTQ KHF L R+R Sbjct: 2198 QTDPPTSIYKRWFIKNTQEKHFELLINRQR 2227 Score = 38.5 bits (88), Expect(2) = 8e-07 Identities = 21/32 (65%), Positives = 25/32 (78%), Gaps = 3/32 (9%) Frame = +3 Query: 489 FFISKDL---SVFSHRELFAHEKISKRLLTSK 575 FF+ KD SVFSHRELFA E++SK LLTS+ Sbjct: 2167 FFLFKDQPPGSVFSHRELFADEEMSKGLLTSQ 2198 >gb|ADD30882.1| putative RF2 protein (chloroplast) [Ehretia acuminata] gi|340806978|gb|AEK71601.1| hypothetical chloroplast RF2 [Ehretia acuminata] Length = 2284 Score = 42.0 bits (97), Expect(2) = 8e-07 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +2 Query: 572 QTRRPRSIHKRWFIKNTQGKHFRLPDCRKR 661 QT P SI+KRWFIKNTQ KHF L R+R Sbjct: 2196 QTDPPTSIYKRWFIKNTQEKHFELLINRQR 2225 Score = 38.5 bits (88), Expect(2) = 8e-07 Identities = 21/32 (65%), Positives = 25/32 (78%), Gaps = 3/32 (9%) Frame = +3 Query: 489 FFISKDL---SVFSHRELFAHEKISKRLLTSK 575 FF+ KD SVFSHRELFA E++SK LLTS+ Sbjct: 2165 FFLFKDQPPGSVFSHRELFADEEMSKGLLTSQ 2196 >ref|YP_009115939.1| hypothetical chloroplast RF2 [Scrophularia takesimensis] gi|752789749|ref|YP_009115959.1| hypothetical chloroplast RF2 [Scrophularia takesimensis] gi|744673783|gb|AJD00768.1| hypothetical chloroplast RF2 [Scrophularia takesimensis] gi|744673804|gb|AJD00789.1| hypothetical chloroplast RF2 [Scrophularia takesimensis] Length = 2282 Score = 42.0 bits (97), Expect(2) = 8e-07 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +2 Query: 572 QTRRPRSIHKRWFIKNTQGKHFRLPDCRKR 661 QT P SI+KRWFIKNTQ KHF L R+R Sbjct: 2194 QTDPPTSIYKRWFIKNTQEKHFELLINRQR 2223 Score = 38.5 bits (88), Expect(2) = 8e-07 Identities = 21/32 (65%), Positives = 25/32 (78%), Gaps = 3/32 (9%) Frame = +3 Query: 489 FFISKDL---SVFSHRELFAHEKISKRLLTSK 575 FF+ KD SVFSHRELFA E++SK LLTS+ Sbjct: 2163 FFLFKDQPPGSVFSHRELFADEEMSKGLLTSQ 2194 >ref|YP_817526.1| hypothetical chloroplast RF2 [Coffea arabica] gi|116617170|ref|YP_817543.1| hypothetical chloroplast RF2 [Coffea arabica] gi|122153663|sp|A0A379.1|YCF2_COFAR RecName: Full=Protein Ycf2 (chloroplast) [Coffea arabica] gi|116242207|gb|ABJ89722.1| hypothetical chloroplast RF2 [Coffea arabica] gi|116242226|gb|ABJ89741.1| hypothetical chloroplast RF2 [Coffea arabica] Length = 2281 Score = 42.0 bits (97), Expect(2) = 8e-07 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +2 Query: 572 QTRRPRSIHKRWFIKNTQGKHFRLPDCRKR 661 QT P SI+KRWFIKNTQ KHF L R+R Sbjct: 2193 QTDPPTSIYKRWFIKNTQEKHFELLINRQR 2222 Score = 38.5 bits (88), Expect(2) = 8e-07 Identities = 21/32 (65%), Positives = 25/32 (78%), Gaps = 3/32 (9%) Frame = +3 Query: 489 FFISKDL---SVFSHRELFAHEKISKRLLTSK 575 FF+ KD SVFSHRELFA E++SK LLTS+ Sbjct: 2162 FFLFKDQPPGSVFSHRELFADEEMSKGLLTSQ 2193