BLASTX nr result
ID: Forsythia21_contig00033489
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00033489 (203 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ93295.1| hypothetical protein AUEXF2481DRAFT_81514 [Aureob... 70 6e-10 ref|XP_007673580.1| hypothetical protein BAUCODRAFT_31468 [Baudo... 70 6e-10 gb|KEQ84974.1| ribosomal protein L18ae [Aureobasidium pullulans ... 69 9e-10 gb|KEQ58402.1| ribosomal L18ae protein family [Aureobasidium mel... 69 9e-10 gb|KEQ75912.1| 60S ribosomal protein L18ae [Aureobasidium namibi... 69 1e-09 gb|EME46101.1| hypothetical protein DOTSEDRAFT_70186 [Dothistrom... 67 4e-09 gb|KJX98876.1| hypothetical protein TI39_contig385g00002 [Zymose... 67 5e-09 ref|XP_007687479.1| hypothetical protein COCMIDRAFT_94025 [Bipol... 67 5e-09 ref|XP_007717889.1| hypothetical protein COCCADRAFT_9694 [Bipola... 67 5e-09 gb|EMD87012.1| hypothetical protein COCHEDRAFT_1227999 [Bipolari... 67 5e-09 ref|XP_007704720.1| hypothetical protein COCSADRAFT_203472 [Bipo... 67 5e-09 ref|XP_003856132.1| 60S ribosomal protein L20, partial [Zymosept... 67 5e-09 emb|CRG90333.1| 60S ribosomal protein L20-A [Talaromyces islandi... 66 8e-09 ref|XP_008020166.1| hypothetical protein SETTUDRAFT_29919 [Setos... 65 1e-08 ref|XP_003297118.1| 60S ribosomal protein L20 [Pyrenophora teres... 64 3e-08 ref|XP_001935145.1| 60S ribosomal protein L20 [Pyrenophora triti... 64 3e-08 ref|XP_007297620.1| 60S ribosomal protein L20 [Marssonina brunne... 64 4e-08 gb|EMF14474.1| 60S ribosomal protein L20 [Sphaerulina musiva SO2... 63 7e-08 gb|KKY22789.1| putative 60s ribosomal protein l20 [Phaeomoniella... 63 9e-08 gb|KKY24724.1| putative 60s ribosomal protein l20 [Diplodia seri... 62 1e-07 >gb|KEQ93295.1| hypothetical protein AUEXF2481DRAFT_81514 [Aureobasidium subglaciale EXF-2481] Length = 175 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -2 Query: 202 RPYIKQLLSKDLKFPLPHRNPPKTGKKVFSAHRPATFF 89 RPYIKQLL+K+LKFPLPHR P GKK+FSAHRPATFF Sbjct: 138 RPYIKQLLTKNLKFPLPHRIPKTAGKKIFSAHRPATFF 175 >ref|XP_007673580.1| hypothetical protein BAUCODRAFT_31468 [Baudoinia compniacensis UAMH 10762] gi|449303144|gb|EMC99152.1| hypothetical protein BAUCODRAFT_31468 [Baudoinia compniacensis UAMH 10762] Length = 148 Score = 70.1 bits (170), Expect = 6e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -2 Query: 202 RPYIKQLLSKDLKFPLPHRNPPKTGKKVFSAHRPATFF 89 RPYIKQLLSKDLKFPLPHR PPK GKKVF+A RP TF+ Sbjct: 111 RPYIKQLLSKDLKFPLPHRVPPKKGKKVFAATRPNTFY 148 >gb|KEQ84974.1| ribosomal protein L18ae [Aureobasidium pullulans EXF-150] Length = 184 Score = 69.3 bits (168), Expect = 9e-10 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -2 Query: 202 RPYIKQLLSKDLKFPLPHRNPPKTGKKVFSAHRPATFF 89 RPYIKQLL+K+LKFPLPHR P GKKVF+AHRPATFF Sbjct: 147 RPYIKQLLTKNLKFPLPHRIPKTAGKKVFAAHRPATFF 184 >gb|KEQ58402.1| ribosomal L18ae protein family [Aureobasidium melanogenum CBS 110374] Length = 174 Score = 69.3 bits (168), Expect = 9e-10 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -2 Query: 202 RPYIKQLLSKDLKFPLPHRNPPKTGKKVFSAHRPATFF 89 RPYIKQLL+K+LKFPLPHR P GKKVF+AHRPATFF Sbjct: 137 RPYIKQLLTKNLKFPLPHRVPKTAGKKVFAAHRPATFF 174 >gb|KEQ75912.1| 60S ribosomal protein L18ae [Aureobasidium namibiae CBS 147.97] Length = 176 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -2 Query: 202 RPYIKQLLSKDLKFPLPHRNPPKTGKKVFSAHRPATFF 89 RPYIKQLL+K+LKFPLPHR P GKK+F+AHRPATFF Sbjct: 139 RPYIKQLLTKNLKFPLPHRIPKTAGKKIFAAHRPATFF 176 >gb|EME46101.1| hypothetical protein DOTSEDRAFT_70186 [Dothistroma septosporum NZE10] Length = 148 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -2 Query: 202 RPYIKQLLSKDLKFPLPHRNPPKTGKKVFSAHRPATFF 89 RPYIKQL +KDLKFPLPHR PPK GKKVF+A RP TF+ Sbjct: 111 RPYIKQLTTKDLKFPLPHRAPPKRGKKVFAATRPNTFY 148 >gb|KJX98876.1| hypothetical protein TI39_contig385g00002 [Zymoseptoria brevis] Length = 233 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -2 Query: 202 RPYIKQLLSKDLKFPLPHRNPPKTGKKVFSAHRPATFF 89 RPYIKQLL+KDLKFPLPHR PPK GK++F+A RP TF+ Sbjct: 196 RPYIKQLLTKDLKFPLPHRAPPKHGKQIFAATRPNTFY 233 >ref|XP_007687479.1| hypothetical protein COCMIDRAFT_94025 [Bipolaris oryzae ATCC 44560] gi|576932459|gb|EUC46000.1| hypothetical protein COCMIDRAFT_94025 [Bipolaris oryzae ATCC 44560] Length = 190 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -2 Query: 202 RPYIKQLLSKDLKFPLPHRNPPKTGKKVFSAHRPATFF 89 RPYIKQLL+K+LKFPLPHR K GKKVF+AHRP+TFF Sbjct: 153 RPYIKQLLTKNLKFPLPHRINKKAGKKVFAAHRPSTFF 190 >ref|XP_007717889.1| hypothetical protein COCCADRAFT_9694 [Bipolaris zeicola 26-R-13] gi|576913358|gb|EUC27801.1| hypothetical protein COCCADRAFT_9694 [Bipolaris zeicola 26-R-13] gi|578485853|gb|EUN23340.1| hypothetical protein COCVIDRAFT_29773 [Bipolaris victoriae FI3] Length = 191 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -2 Query: 202 RPYIKQLLSKDLKFPLPHRNPPKTGKKVFSAHRPATFF 89 RPYIKQLL+K+LKFPLPHR K GKKVF+AHRP+TFF Sbjct: 154 RPYIKQLLTKNLKFPLPHRINKKAGKKVFAAHRPSTFF 191 >gb|EMD87012.1| hypothetical protein COCHEDRAFT_1227999 [Bipolaris maydis C5] gi|477586910|gb|ENI03993.1| hypothetical protein COCC4DRAFT_198673 [Bipolaris maydis ATCC 48331] Length = 205 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -2 Query: 202 RPYIKQLLSKDLKFPLPHRNPPKTGKKVFSAHRPATFF 89 RPYIKQLL+K+LKFPLPHR K GKKVF+AHRP+TFF Sbjct: 168 RPYIKQLLTKNLKFPLPHRINKKAGKKVFAAHRPSTFF 205 >ref|XP_007704720.1| hypothetical protein COCSADRAFT_203472 [Bipolaris sorokiniana ND90Pr] gi|451846424|gb|EMD59734.1| hypothetical protein COCSADRAFT_203472 [Bipolaris sorokiniana ND90Pr] Length = 190 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -2 Query: 202 RPYIKQLLSKDLKFPLPHRNPPKTGKKVFSAHRPATFF 89 RPYIKQLL+K+LKFPLPHR K GKKVF+AHRP+TFF Sbjct: 153 RPYIKQLLTKNLKFPLPHRINKKAGKKVFAAHRPSTFF 190 >ref|XP_003856132.1| 60S ribosomal protein L20, partial [Zymoseptoria tritici IPO323] gi|339476017|gb|EGP91108.1| hypothetical protein MYCGRDRAFT_34437, partial [Zymoseptoria tritici IPO323] Length = 173 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -2 Query: 202 RPYIKQLLSKDLKFPLPHRNPPKTGKKVFSAHRPATFF 89 RPYIKQLL+KDLKFPLPHR PPK GK++F+A RP TF+ Sbjct: 136 RPYIKQLLTKDLKFPLPHRAPPKHGKQIFAATRPNTFY 173 >emb|CRG90333.1| 60S ribosomal protein L20-A [Talaromyces islandicus] Length = 174 Score = 66.2 bits (160), Expect = 8e-09 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -2 Query: 202 RPYIKQLLSKDLKFPLPHRNPPKTGKKVFSAHRPATF 92 RPYIKQLL+KDLKFPLPHR PP++GKK+F+ RP+TF Sbjct: 137 RPYIKQLLAKDLKFPLPHRAPPQSGKKIFAYKRPSTF 173 >ref|XP_008020166.1| hypothetical protein SETTUDRAFT_29919 [Setosphaeria turcica Et28A] gi|482814702|gb|EOA91377.1| hypothetical protein SETTUDRAFT_29919 [Setosphaeria turcica Et28A] Length = 173 Score = 65.5 bits (158), Expect = 1e-08 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -2 Query: 202 RPYIKQLLSKDLKFPLPHRNPPKTGKKVFSAHRPATFF 89 RPYIKQLL+K+LKFPLPHR K GKKVFSA+RP+TFF Sbjct: 136 RPYIKQLLTKNLKFPLPHRINKKAGKKVFSANRPSTFF 173 >ref|XP_003297118.1| 60S ribosomal protein L20 [Pyrenophora teres f. teres 0-1] gi|311330357|gb|EFQ94776.1| hypothetical protein PTT_07431 [Pyrenophora teres f. teres 0-1] Length = 175 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -2 Query: 202 RPYIKQLLSKDLKFPLPHRNPPKTGKKVFSAHRPATFF 89 RPYIKQLL+K+LKFPLPHR K GKKVFSA RP+TFF Sbjct: 138 RPYIKQLLTKNLKFPLPHRINKKAGKKVFSATRPSTFF 175 >ref|XP_001935145.1| 60S ribosomal protein L20 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187981093|gb|EDU47719.1| 60S ribosomal protein L18ae [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 174 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -2 Query: 202 RPYIKQLLSKDLKFPLPHRNPPKTGKKVFSAHRPATFF 89 RPYIKQLL+K+LKFPLPHR K GKKVFSA RP+TFF Sbjct: 137 RPYIKQLLTKNLKFPLPHRINKKAGKKVFSATRPSTFF 174 >ref|XP_007297620.1| 60S ribosomal protein L20 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406859021|gb|EKD12094.1| 60S ribosomal protein L20 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 242 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -2 Query: 202 RPYIKQLLSKDLKFPLPHRNPPKTGKKVFSAHRPATFF 89 RPYIKQLL+KDLKFPLPHR TGKK+FS RP+TF+ Sbjct: 205 RPYIKQLLTKDLKFPLPHRVSKSTGKKIFSGSRPSTFY 242 >gb|EMF14474.1| 60S ribosomal protein L20 [Sphaerulina musiva SO2202] Length = 204 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -2 Query: 202 RPYIKQLLSKDLKFPLPHRNPPKTGKKVFSAHRPATFF 89 RPYIKQL +K+LKFPLPHR PK+GKKVF+A RP TF+ Sbjct: 167 RPYIKQLTTKNLKFPLPHRAAPKSGKKVFAATRPNTFY 204 >gb|KKY22789.1| putative 60s ribosomal protein l20 [Phaeomoniella chlamydospora] Length = 174 Score = 62.8 bits (151), Expect = 9e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -2 Query: 202 RPYIKQLLSKDLKFPLPHRNPPKTGKKVFSAHRPATF 92 RPYIKQL+SKDLKFPLPHR+P KK+FS+ RP+TF Sbjct: 137 RPYIKQLISKDLKFPLPHRSPKANQKKIFSSKRPSTF 173 >gb|KKY24724.1| putative 60s ribosomal protein l20 [Diplodia seriata] Length = 174 Score = 62.0 bits (149), Expect = 1e-07 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -2 Query: 202 RPYIKQLLSKDLKFPLPHRNPPKTGKKVFSAHRPATFF 89 RPYIKQ+L+KDLKFPLPHR T KK+F+A+RP+TFF Sbjct: 137 RPYIKQVLAKDLKFPLPHRVNKTTSKKIFTANRPSTFF 174