BLASTX nr result
ID: Forsythia21_contig00033461
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00033461 (260 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ97389.1| hypothetical protein AUEXF2481DRAFT_46397 [Aureob... 78 3e-12 ref|XP_003857349.1| proteasome regulatory particle subunit RPT1 ... 78 3e-12 gb|KEQ64194.1| 26S proteasome subunit P45 [Aureobasidium melanog... 77 3e-12 ref|XP_007912828.1| putative 26s protease regulatory subunit 7 p... 77 3e-12 gb|KJZ78338.1| 26S protease regulatory subunit 7-like protein [H... 77 5e-12 gb|KJK79106.1| 26S protease regulatory subunit 7 [Metarhizium an... 77 5e-12 gb|KHN99987.1| 26S protease regulatory subunit 7 [Metarhizium al... 77 5e-12 ref|XP_011316240.1| 26S protease regulatory subunit 7 [Fusarium ... 77 5e-12 emb|CCT63484.1| probable 26S proteasome regulatory subunit YTA3 ... 77 5e-12 ref|XP_009252650.1| hypothetical protein FPSE_01255 [Fusarium ps... 77 5e-12 ref|XP_007809365.1| 26S protease regulatory subunit 7 [Metarhizi... 77 5e-12 gb|KIM97760.1| hypothetical protein OIDMADRAFT_167903 [Oidiodend... 77 6e-12 gb|KIL95081.1| hypothetical protein FAVG1_02013 [Fusarium avenac... 77 6e-12 gb|KFH47294.1| 26S protease regulatory subunit-like protein [Acr... 77 6e-12 gb|KFA70425.1| hypothetical protein S40285_00656 [Stachybotrys c... 77 6e-12 gb|EME50405.1| hypothetical protein DOTSEDRAFT_141754 [Dothistro... 77 6e-12 ref|XP_009217629.1| 26S protease regulatory subunit 7 [Gaeumanno... 77 6e-12 gb|EGU81068.1| hypothetical protein FOXB_08416 [Fusarium oxyspor... 77 6e-12 ref|XP_003054283.1| predicted protein [Nectria haematococca mpVI... 77 6e-12 gb|KIW07575.1| 26S protease regulatory subunit 7 [Verruconis gal... 76 8e-12 >gb|KEQ97389.1| hypothetical protein AUEXF2481DRAFT_46397 [Aureobasidium subglaciale EXF-2481] Length = 439 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 170 TGSNWEKYQKKFADDEVEEKKITPLSDEDIQVLKTYG 60 TGSNWEKYQKKFADDE EEKKITPLSDEDIQVLKTYG Sbjct: 5 TGSNWEKYQKKFADDEPEEKKITPLSDEDIQVLKTYG 41 >ref|XP_003857349.1| proteasome regulatory particle subunit RPT1 [Zymoseptoria tritici IPO323] gi|339477234|gb|EGP92325.1| hypothetical protein MYCGRDRAFT_53126 [Zymoseptoria tritici IPO323] gi|796707341|gb|KJX98628.1| 26s protease regulatory subunit 7 like protein [Zymoseptoria brevis] Length = 438 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 170 TGSNWEKYQKKFADDEVEEKKITPLSDEDIQVLKTY 63 TGSNWEKYQKKFADDEVEEKKITPLSDEDIQVLKTY Sbjct: 5 TGSNWEKYQKKFADDEVEEKKITPLSDEDIQVLKTY 40 >gb|KEQ64194.1| 26S proteasome subunit P45 [Aureobasidium melanogenum CBS 110374] Length = 438 Score = 77.4 bits (189), Expect = 3e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -1 Query: 170 TGSNWEKYQKKFADDEVEEKKITPLSDEDIQVLKTYG 60 TG NWEKYQKKFADDEVEEKKITPL+DEDIQVLKTYG Sbjct: 5 TGQNWEKYQKKFADDEVEEKKITPLTDEDIQVLKTYG 41 >ref|XP_007912828.1| putative 26s protease regulatory subunit 7 protein [Togninia minima UCRPA7] gi|500259680|gb|EOO02463.1| putative 26s protease regulatory subunit 7 protein [Togninia minima UCRPA7] Length = 439 Score = 77.4 bits (189), Expect = 3e-12 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -1 Query: 170 TGSNWEKYQKKFADDEVEEKKITPLSDEDIQVLKTYG 60 TGSNWEKYQKK+ADDE+EEKKITPL+DEDIQVLKTYG Sbjct: 5 TGSNWEKYQKKYADDEIEEKKITPLTDEDIQVLKTYG 41 >gb|KJZ78338.1| 26S protease regulatory subunit 7-like protein [Hirsutella minnesotensis 3608] Length = 440 Score = 77.0 bits (188), Expect = 5e-12 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -1 Query: 170 TGSNWEKYQKKFADDEVEEKKITPLSDEDIQVLKTYG 60 TG NWEKYQKKFADDE+EEKKITPL+DEDIQVLKTYG Sbjct: 5 TGQNWEKYQKKFADDEIEEKKITPLTDEDIQVLKTYG 41 >gb|KJK79106.1| 26S protease regulatory subunit 7 [Metarhizium anisopliae BRIP 53293] gi|770405218|gb|KJK90134.1| 26S protease regulatory subunit 7-like protein [Metarhizium anisopliae BRIP 53284] Length = 500 Score = 77.0 bits (188), Expect = 5e-12 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -1 Query: 170 TGSNWEKYQKKFADDEVEEKKITPLSDEDIQVLKTYG 60 TG NWEKYQKKFADDE+EEKKITPL+DEDIQVLKTYG Sbjct: 65 TGQNWEKYQKKFADDEIEEKKITPLTDEDIQVLKTYG 101 >gb|KHN99987.1| 26S protease regulatory subunit 7 [Metarhizium album ARSEF 1941] Length = 440 Score = 77.0 bits (188), Expect = 5e-12 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -1 Query: 170 TGSNWEKYQKKFADDEVEEKKITPLSDEDIQVLKTYG 60 TG NWEKYQKKFADDE+EEKKITPL+DEDIQVLKTYG Sbjct: 5 TGQNWEKYQKKFADDEIEEKKITPLTDEDIQVLKTYG 41 >ref|XP_011316240.1| 26S protease regulatory subunit 7 [Fusarium graminearum PH-1] gi|558855672|gb|ESU05755.1| 26S protease regulatory subunit 7 [Fusarium graminearum PH-1] gi|596541849|gb|EYB22388.1| hypothetical protein FG05_00559 [Fusarium graminearum] Length = 440 Score = 77.0 bits (188), Expect = 5e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -1 Query: 170 TGSNWEKYQKKFADDEVEEKKITPLSDEDIQVLKTYG 60 TGSNWEKYQK FADDEVEEKKITPL+DEDIQVLKTYG Sbjct: 5 TGSNWEKYQKNFADDEVEEKKITPLTDEDIQVLKTYG 41 >emb|CCT63484.1| probable 26S proteasome regulatory subunit YTA3 [Fusarium fujikuroi IMI 58289] gi|584127974|gb|EWG37393.1| 26S protease regulatory subunit 7 [Fusarium verticillioides 7600] gi|829120067|gb|KLO96185.1| putative 26S proteasome regulatory subunit YTA3 [Fusarium fujikuroi] gi|829129162|gb|KLP03879.1| putative 26S proteasome regulatory subunit YTA3 [Fusarium fujikuroi] gi|829152315|gb|KLP20098.1| putative 26S proteasome regulatory subunit YTA3 [Fusarium fujikuroi] Length = 440 Score = 77.0 bits (188), Expect = 5e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -1 Query: 170 TGSNWEKYQKKFADDEVEEKKITPLSDEDIQVLKTYG 60 TGSNWEKYQK FADDEVEEKKITPL+DEDIQVLKTYG Sbjct: 5 TGSNWEKYQKNFADDEVEEKKITPLTDEDIQVLKTYG 41 >ref|XP_009252650.1| hypothetical protein FPSE_01255 [Fusarium pseudograminearum CS3096] gi|408399488|gb|EKJ78589.1| hypothetical protein FPSE_01255 [Fusarium pseudograminearum CS3096] gi|699041525|emb|CEF72512.1| unnamed protein product [Fusarium graminearum] Length = 444 Score = 77.0 bits (188), Expect = 5e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -1 Query: 170 TGSNWEKYQKKFADDEVEEKKITPLSDEDIQVLKTYG 60 TGSNWEKYQK FADDEVEEKKITPL+DEDIQVLKTYG Sbjct: 9 TGSNWEKYQKNFADDEVEEKKITPLTDEDIQVLKTYG 45 >ref|XP_007809365.1| 26S protease regulatory subunit 7 [Metarhizium acridum CQMa 102] gi|629716878|ref|XP_007820347.1| hypothetical protein MAA_04158 [Metarhizium robertsii ARSEF 23] gi|322699145|gb|EFY90909.1| 26S protease regulatory subunit 7 [Metarhizium acridum CQMa 102] gi|322708804|gb|EFZ00381.1| hypothetical protein MAA_04158 [Metarhizium robertsii ARSEF 23] gi|594719966|gb|EXV02855.1| 26S proteasome regulatory subunit domain protein [Metarhizium robertsii] gi|672385583|gb|KFG87670.1| 26S protease regulatory subunit 7 [Metarhizium anisopliae] gi|743635303|gb|KID66687.1| 26S protease regulatory subunit 7, partial [Metarhizium anisopliae ARSEF 549] gi|743645951|gb|KID77069.1| 26S protease regulatory subunit 7, partial [Metarhizium brunneum ARSEF 3297] gi|743662913|gb|KID90100.1| 26S protease regulatory subunit 7 [Metarhizium guizhouense ARSEF 977] gi|743676290|gb|KIE03204.1| 26S protease regulatory subunit 7, partial [Metarhizium majus ARSEF 297] Length = 440 Score = 77.0 bits (188), Expect = 5e-12 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -1 Query: 170 TGSNWEKYQKKFADDEVEEKKITPLSDEDIQVLKTYG 60 TG NWEKYQKKFADDE+EEKKITPL+DEDIQVLKTYG Sbjct: 5 TGQNWEKYQKKFADDEIEEKKITPLTDEDIQVLKTYG 41 >gb|KIM97760.1| hypothetical protein OIDMADRAFT_167903 [Oidiodendron maius Zn] Length = 439 Score = 76.6 bits (187), Expect = 6e-12 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -1 Query: 170 TGSNWEKYQKKFADDEVEEKKITPLSDEDIQVLKTYG 60 TGSNWEKY+K+FADDE+EEKKITPLSDEDIQVLKTYG Sbjct: 5 TGSNWEKYKKEFADDEIEEKKITPLSDEDIQVLKTYG 41 >gb|KIL95081.1| hypothetical protein FAVG1_02013 [Fusarium avenaceum] Length = 440 Score = 76.6 bits (187), Expect = 6e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -1 Query: 170 TGSNWEKYQKKFADDEVEEKKITPLSDEDIQVLKTYG 60 TGSNWEKYQK FADDEVEEKKITPL+DEDIQVLKTYG Sbjct: 5 TGSNWEKYQKTFADDEVEEKKITPLTDEDIQVLKTYG 41 >gb|KFH47294.1| 26S protease regulatory subunit-like protein [Acremonium chrysogenum ATCC 11550] Length = 440 Score = 76.6 bits (187), Expect = 6e-12 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = -1 Query: 170 TGSNWEKYQKKFADDEVEEKKITPLSDEDIQVLKTYG 60 TG NWEKYQK FADDEVEEKKITPLSDEDIQVLKTYG Sbjct: 5 TGQNWEKYQKNFADDEVEEKKITPLSDEDIQVLKTYG 41 >gb|KFA70425.1| hypothetical protein S40285_00656 [Stachybotrys chlorohalonata IBT 40285] Length = 440 Score = 76.6 bits (187), Expect = 6e-12 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -1 Query: 170 TGSNWEKYQKKFADDEVEEKKITPLSDEDIQVLKTYG 60 TGSNWEKYQK FADDE+EEKKITPL+DEDIQVLKTYG Sbjct: 5 TGSNWEKYQKNFADDEIEEKKITPLTDEDIQVLKTYG 41 >gb|EME50405.1| hypothetical protein DOTSEDRAFT_141754 [Dothistroma septosporum NZE10] Length = 439 Score = 76.6 bits (187), Expect = 6e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 170 TGSNWEKYQKKFADDEVEEKKITPLSDEDIQVLKTY 63 TGSNWEKYQKKFADDEVEEKKITPL+DEDIQVLKTY Sbjct: 5 TGSNWEKYQKKFADDEVEEKKITPLTDEDIQVLKTY 40 >ref|XP_009217629.1| 26S protease regulatory subunit 7 [Gaeumannomyces graminis var. tritici R3-111a-1] gi|402086722|gb|EJT81620.1| 26S protease regulatory subunit 7 [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 439 Score = 76.6 bits (187), Expect = 6e-12 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -1 Query: 170 TGSNWEKYQKKFADDEVEEKKITPLSDEDIQVLKTYG 60 TG NWEK+QKKFADDE+EEKKITPLSDEDIQVLKTYG Sbjct: 5 TGQNWEKFQKKFADDEIEEKKITPLSDEDIQVLKTYG 41 >gb|EGU81068.1| hypothetical protein FOXB_08416 [Fusarium oxysporum Fo5176] gi|475664161|gb|EMT61956.1| 26S protease regulatory subunit 7 like protein [Fusarium oxysporum f. sp. cubense race 4] gi|477507692|gb|ENH60986.1| 26S protease regulatory subunit 7 like protein [Fusarium oxysporum f. sp. cubense race 1] gi|587671543|gb|EWY93884.1| 26S protease regulatory subunit 7 [Fusarium oxysporum FOSC 3-a] gi|587704219|gb|EWZ50824.1| 26S protease regulatory subunit 7 [Fusarium oxysporum Fo47] gi|587720376|gb|EWZ91713.1| 26S protease regulatory subunit 7 [Fusarium oxysporum f. sp. lycopersici MN25] gi|587755251|gb|EXA52967.1| 26S protease regulatory subunit 7 [Fusarium oxysporum f. sp. pisi HDV247] gi|590046208|gb|EXK48066.1| 26S protease regulatory subunit 7 [Fusarium oxysporum f. sp. melonis 26406] gi|590060666|gb|EXK88190.1| 26S protease regulatory subunit 7 [Fusarium oxysporum f. sp. raphani 54005] gi|591414608|gb|EXL49745.1| 26S protease regulatory subunit 7 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591442426|gb|EXL75029.1| 26S protease regulatory subunit 7 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591480160|gb|EXM11220.1| 26S protease regulatory subunit 7 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591494529|gb|EXM24077.1| 26S protease regulatory subunit 7 [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 440 Score = 76.6 bits (187), Expect = 6e-12 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -1 Query: 170 TGSNWEKYQKKFADDEVEEKKITPLSDEDIQVLKTYG 60 TGSNWEKYQK FADDE+EEKKITPL+DEDIQVLKTYG Sbjct: 5 TGSNWEKYQKNFADDEIEEKKITPLTDEDIQVLKTYG 41 >ref|XP_003054283.1| predicted protein [Nectria haematococca mpVI 77-13-4] gi|256735224|gb|EEU48570.1| predicted protein [Nectria haematococca mpVI 77-13-4] Length = 440 Score = 76.6 bits (187), Expect = 6e-12 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -1 Query: 170 TGSNWEKYQKKFADDEVEEKKITPLSDEDIQVLKTYG 60 TGSNWEKYQK FADDE+EEKKITPL+DEDIQVLKTYG Sbjct: 5 TGSNWEKYQKNFADDEIEEKKITPLTDEDIQVLKTYG 41 >gb|KIW07575.1| 26S protease regulatory subunit 7 [Verruconis gallopava] Length = 438 Score = 76.3 bits (186), Expect = 8e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -1 Query: 170 TGSNWEKYQKKFADDEVEEKKITPLSDEDIQVLKTYG 60 TG NWEKYQK FADDE+EEKKITPLSDEDIQVLKTYG Sbjct: 5 TGQNWEKYQKNFADDEIEEKKITPLSDEDIQVLKTYG 41