BLASTX nr result
ID: Forsythia21_contig00033414
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00033414 (253 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008238996.1| PREDICTED: cation/H(+) antiporter 18-like [P... 64 4e-08 ref|XP_007210361.1| hypothetical protein PRUPE_ppa001551mg [Prun... 64 4e-08 ref|XP_007040405.1| Cation/H+ exchanger 18 isoform 1 [Theobroma ... 60 4e-07 ref|XP_009782586.1| PREDICTED: cation/H(+) antiporter 18-like [N... 56 8e-06 >ref|XP_008238996.1| PREDICTED: cation/H(+) antiporter 18-like [Prunus mume] Length = 800 Score = 63.9 bits (154), Expect = 4e-08 Identities = 32/47 (68%), Positives = 37/47 (78%) Frame = -3 Query: 251 PELGPIGSLLISPEFCTTASVLVVQQYQEKVSPNSTLETLDESPNRD 111 PELGP+GSLLISP+F T+ASVLVVQQY +VS N E +ESP RD Sbjct: 754 PELGPLGSLLISPDFSTSASVLVVQQYNGQVSLNLASEIEEESPERD 800 >ref|XP_007210361.1| hypothetical protein PRUPE_ppa001551mg [Prunus persica] gi|462406096|gb|EMJ11560.1| hypothetical protein PRUPE_ppa001551mg [Prunus persica] Length = 804 Score = 63.9 bits (154), Expect = 4e-08 Identities = 32/47 (68%), Positives = 37/47 (78%) Frame = -3 Query: 251 PELGPIGSLLISPEFCTTASVLVVQQYQEKVSPNSTLETLDESPNRD 111 PELGP+GSLLISP+F T+ASVLVVQQY +VS N E +ESP RD Sbjct: 754 PELGPLGSLLISPDFSTSASVLVVQQYNGQVSLNLASEIEEESPERD 800 >ref|XP_007040405.1| Cation/H+ exchanger 18 isoform 1 [Theobroma cacao] gi|590678812|ref|XP_007040406.1| Cation/H+ exchanger 18 isoform 1 [Theobroma cacao] gi|508777650|gb|EOY24906.1| Cation/H+ exchanger 18 isoform 1 [Theobroma cacao] gi|508777651|gb|EOY24907.1| Cation/H+ exchanger 18 isoform 1 [Theobroma cacao] Length = 803 Score = 60.5 bits (145), Expect = 4e-07 Identities = 29/47 (61%), Positives = 36/47 (76%) Frame = -3 Query: 251 PELGPIGSLLISPEFCTTASVLVVQQYQEKVSPNSTLETLDESPNRD 111 PELGP+G LLISP+F TASVLVVQQY +VS N + +ESP++D Sbjct: 753 PELGPVGCLLISPDFSATASVLVVQQYHGRVSLNLASDMEEESPDKD 799 >ref|XP_009782586.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana sylvestris] Length = 801 Score = 56.2 bits (134), Expect = 8e-06 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -3 Query: 251 PELGPIGSLLISPEFCTTASVLVVQQYQEKVSPNSTLETLDE 126 PELGP+G+LLISPEF TTASVLVVQ+Y+ ++S +S L TL E Sbjct: 748 PELGPLGNLLISPEFSTTASVLVVQKYRSELSQDS-LSTLKE 788