BLASTX nr result
ID: Forsythia21_contig00033389
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00033389 (477 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003850653.1| 40S ribosomal protein S28 [Zymoseptoria trit... 112 9e-23 gb|EMR82428.1| putative 40s ribosomal protein s28 protein [Botry... 112 1e-22 ref|XP_008085508.1| Nucleic acid-binding protein [Glarea lozoyen... 111 2e-22 ref|XP_007681584.1| hypothetical protein BAUCODRAFT_315059 [Baud... 110 3e-22 gb|EKG14828.1| Ribosomal protein S28e [Macrophomina phaseolina M... 110 4e-22 ref|XP_002153086.1| 40S ribosomal protein S28 [Talaromyces marne... 110 5e-22 gb|ESZ95319.1| 40S ribosomal protein S28 [Sclerotinia borealis F... 110 5e-22 ref|XP_012743726.1| 40S ribosomal protein S28 [Pseudogymnoascus ... 110 5e-22 ref|XP_003009124.1| 40S ribosomal protein S28 [Verticillium alfa... 108 1e-21 ref|XP_007779255.1| 40S ribosomal protein S28 [Coniosporium apol... 108 1e-21 ref|XP_007582595.1| putative 40s ribosomal protein s28 protein [... 108 1e-21 ref|XP_001561242.1| 40S ribosomal protein S28 [Botrytis cinerea ... 108 1e-21 ref|XP_007600844.1| 40S ribosomal protein S28 [Colletotrichum fi... 107 2e-21 ref|XP_007827699.1| 40S ribosomal protein S28 [Pestalotiopsis fi... 107 2e-21 gb|KDB13252.1| IBR domain-containing protein [Ustilaginoidea vir... 107 3e-21 ref|XP_003000163.1| 40S ribosomal protein S28 [Verticillium alfa... 107 3e-21 ref|XP_007915668.1| putative 40s ribosomal protein s28 protein [... 107 3e-21 gb|KKA26499.1| hypothetical protein TD95_004483 [Thielaviopsis p... 107 4e-21 gb|KIW01680.1| 40S ribosomal protein S28 [Verruconis gallopava] 106 5e-21 gb|ERS99836.1| 40S ribosomal protein S28 [Sporothrix schenckii A... 106 5e-21 >ref|XP_003850653.1| 40S ribosomal protein S28 [Zymoseptoria tritici IPO323] gi|631388890|ref|XP_007928825.1| hypothetical protein MYCFIDRAFT_49708 [Pseudocercospora fijiensis CIRAD86] gi|339470532|gb|EGP85629.1| hypothetical protein MYCGRDRAFT_81501 [Zymoseptoria tritici IPO323] gi|452980191|gb|EME79952.1| hypothetical protein MYCFIDRAFT_49708 [Pseudocercospora fijiensis CIRAD86] gi|752275464|dbj|GAM89234.1| hypothetical protein ANO11243_072710 [fungal sp. No.11243] gi|796706002|gb|KJX97506.1| 40s ribosomal protein s28 [Zymoseptoria brevis] Length = 68 Score = 112 bits (280), Expect = 9e-23 Identities = 56/56 (100%), Positives = 56/56 (100%) Frame = +2 Query: 53 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 220 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 56 >gb|EMR82428.1| putative 40s ribosomal protein s28 protein [Botrytis cinerea BcDW1] Length = 114 Score = 112 bits (279), Expect = 1e-22 Identities = 55/58 (94%), Positives = 58/58 (100%) Frame = +2 Query: 47 AKMDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 220 AKM+++KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC Sbjct: 45 AKMEASKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 102 >ref|XP_008085508.1| Nucleic acid-binding protein [Glarea lozoyensis ATCC 20868] gi|512199315|gb|EPE28149.1| Nucleic acid-binding protein [Glarea lozoyensis ATCC 20868] gi|751749436|gb|KIM97619.1| hypothetical protein OIDMADRAFT_20164 [Oidiodendron maius Zn] Length = 68 Score = 111 bits (277), Expect = 2e-22 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = +2 Query: 53 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 220 MDS+KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC Sbjct: 1 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 56 >ref|XP_007681584.1| hypothetical protein BAUCODRAFT_315059 [Baudoinia compniacensis UAMH 10762] gi|449295094|gb|EMC91116.1| hypothetical protein BAUCODRAFT_315059 [Baudoinia compniacensis UAMH 10762] gi|662503260|gb|KEQ60881.1| ribosomal protein S28e [Aureobasidium melanogenum CBS 110374] gi|662518527|gb|KEQ76087.1| ribosomal protein S28e [Aureobasidium namibiae CBS 147.97] gi|662527623|gb|KEQ85002.1| ribosomal protein S28e [Aureobasidium pullulans EXF-150] Length = 68 Score = 110 bits (276), Expect = 3e-22 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = +2 Query: 53 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 220 M+SAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC Sbjct: 1 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 56 >gb|EKG14828.1| Ribosomal protein S28e [Macrophomina phaseolina MS6] gi|407924574|gb|EKG17607.1| Histone core [Macrophomina phaseolina MS6] gi|821064263|gb|KKY19538.1| putative 40s ribosomal protein s28 [Diplodia seriata] gi|821064801|gb|KKY20058.1| putative 40s ribosomal protein s28 [Diplodia seriata] Length = 68 Score = 110 bits (275), Expect = 4e-22 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = +2 Query: 53 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 220 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRE+DILC Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 56 >ref|XP_002153086.1| 40S ribosomal protein S28 [Talaromyces marneffei ATCC 18224] gi|242820646|ref|XP_002487548.1| 40S ribosomal protein S28 [Talaromyces stipitatus ATCC 10500] gi|242820650|ref|XP_002487549.1| 40S ribosomal protein S28 [Talaromyces stipitatus ATCC 10500] gi|210064606|gb|EEA18701.1| Ribosomal protein S28e [Talaromyces marneffei ATCC 18224] gi|218714013|gb|EED13437.1| Ribosomal protein S28e [Talaromyces stipitatus ATCC 10500] gi|218714014|gb|EED13438.1| Ribosomal protein S28e [Talaromyces stipitatus ATCC 10500] gi|680000722|gb|KFX52824.1| 40S ribosomal protein S28 [Talaromyces marneffei PM1] gi|748550736|dbj|GAM43411.1| ribosomal protein [Talaromyces cellulolyticus] gi|816186318|emb|CRG91631.1| hypothetical protein PISL3812_08681 [Talaromyces islandicus] Length = 68 Score = 110 bits (274), Expect = 5e-22 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = +2 Query: 53 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 220 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDILC Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >gb|ESZ95319.1| 40S ribosomal protein S28 [Sclerotinia borealis F-4157] Length = 68 Score = 110 bits (274), Expect = 5e-22 Identities = 54/56 (96%), Positives = 56/56 (100%) Frame = +2 Query: 53 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 220 MD++KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC Sbjct: 1 MDASKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 56 >ref|XP_012743726.1| 40S ribosomal protein S28 [Pseudogymnoascus destructans 20631-21] gi|440632220|gb|ELR02139.1| 40S ribosomal protein S28 [Pseudogymnoascus destructans 20631-21] Length = 68 Score = 110 bits (274), Expect = 5e-22 Identities = 54/56 (96%), Positives = 56/56 (100%) Frame = +2 Query: 53 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 220 MD++KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC Sbjct: 1 MDTSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 56 >ref|XP_003009124.1| 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] gi|697069809|ref|XP_009650088.1| hypothetical protein VDAG_00416 [Verticillium dahliae VdLs.17] gi|261352270|gb|EEY14698.1| 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] gi|346970282|gb|EGY13734.1| hypothetical protein VDAG_00416 [Verticillium dahliae VdLs.17] Length = 68 Score = 108 bits (271), Expect = 1e-21 Identities = 54/56 (96%), Positives = 55/56 (98%) Frame = +2 Query: 53 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 220 MDS+KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDILC Sbjct: 1 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >ref|XP_007779255.1| 40S ribosomal protein S28 [Coniosporium apollinis CBS 100218] gi|494826922|gb|EON63938.1| 40S ribosomal protein S28 [Coniosporium apollinis CBS 100218] Length = 68 Score = 108 bits (271), Expect = 1e-21 Identities = 54/56 (96%), Positives = 56/56 (100%) Frame = +2 Query: 53 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 220 MDSAKVPVKLVKVTRVLGRTGSRGGV+QVRVEFMDDTTRSIIRNVKGPVRE+DILC Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVSQVRVEFMDDTTRSIIRNVKGPVRENDILC 56 >ref|XP_007582595.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] gi|615415585|ref|XP_007584949.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] gi|485922014|gb|EOD47615.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] gi|485925270|gb|EOD49893.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] Length = 68 Score = 108 bits (271), Expect = 1e-21 Identities = 54/56 (96%), Positives = 56/56 (100%) Frame = +2 Query: 53 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 220 M+SAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRE+DILC Sbjct: 1 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 56 >ref|XP_001561242.1| 40S ribosomal protein S28 [Botrytis cinerea B05.10] gi|347829972|emb|CCD45669.1| hypothetical protein BofuT4P34000010001 [Botrytis cinerea T4] Length = 68 Score = 108 bits (270), Expect = 1e-21 Identities = 53/56 (94%), Positives = 56/56 (100%) Frame = +2 Query: 53 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 220 M+++KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC Sbjct: 1 MEASKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 56 >ref|XP_007600844.1| 40S ribosomal protein S28 [Colletotrichum fioriniae PJ7] gi|588893325|gb|EXF75473.1| 40S ribosomal protein S28 [Colletotrichum fioriniae PJ7] Length = 68 Score = 107 bits (268), Expect = 2e-21 Identities = 54/56 (96%), Positives = 54/56 (96%) Frame = +2 Query: 53 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 220 MDSAK PVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDILC Sbjct: 1 MDSAKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDETRSIIRNVKGPVREDDILC 56 >ref|XP_007827699.1| 40S ribosomal protein S28 [Pestalotiopsis fici W106-1] gi|827075690|ref|XP_008099256.1| ribosomal protein S28e [Colletotrichum graminicola M1.001] gi|310800343|gb|EFQ35236.1| ribosomal protein S28e [Colletotrichum graminicola M1.001] gi|380474013|emb|CCF46007.1| 40S ribosomal protein S28 [Colletotrichum higginsianum] gi|573067571|gb|ETS87099.1| 40S ribosomal protein S28 [Pestalotiopsis fici W106-1] gi|640921526|gb|KDN65874.1| putative 40S ribosomal protein S28 [Colletotrichum sublineola] Length = 68 Score = 107 bits (268), Expect = 2e-21 Identities = 54/56 (96%), Positives = 54/56 (96%) Frame = +2 Query: 53 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 220 MDSAK PVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDILC Sbjct: 1 MDSAKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >gb|KDB13252.1| IBR domain-containing protein [Ustilaginoidea virens] Length = 480 Score = 107 bits (267), Expect = 3e-21 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = +2 Query: 53 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 220 MDS+K PVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDILC Sbjct: 413 MDSSKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 468 >ref|XP_003000163.1| 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] gi|697076619|ref|XP_009652495.1| 40S ribosomal protein S28 [Verticillium dahliae VdLs.17] gi|261360820|gb|EEY23248.1| 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] gi|346979706|gb|EGY23158.1| 40S ribosomal protein S28 [Verticillium dahliae VdLs.17] gi|729185410|emb|CEJ91264.1| Putative 40S ribosomal protein S28 [Torrubiella hemipterigena] Length = 68 Score = 107 bits (267), Expect = 3e-21 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = +2 Query: 53 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 220 MDS+K PVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDILC Sbjct: 1 MDSSKTPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >ref|XP_007915668.1| putative 40s ribosomal protein s28 protein [Togninia minima UCRPA7] gi|399165856|emb|CCE33319.1| probable ribosomal protein S28B [Claviceps purpurea 20.1] gi|500256292|gb|EON99563.1| putative 40s ribosomal protein s28 protein [Togninia minima UCRPA7] gi|594720915|gb|EXV03803.1| ribosomal protein S28e [Metarhizium robertsii] gi|672383491|gb|KFG85603.1| 40S ribosomal protein S28 [Metarhizium anisopliae] gi|743638615|gb|KID69986.1| Ribosomal protein S28e, partial [Metarhizium anisopliae ARSEF 549] gi|743641156|gb|KID72508.1| Ribosomal protein S28e, partial [Metarhizium brunneum ARSEF 3297] gi|743662232|gb|KID89430.1| Ribosomal protein S28e [Metarhizium guizhouense ARSEF 977] gi|770389641|gb|KJK75639.1| hypothetical protein H634G_09003 [Metarhizium anisopliae BRIP 53293] gi|770409186|gb|KJK93999.1| hypothetical protein H633G_02099 [Metarhizium anisopliae BRIP 53284] gi|799246995|gb|KJZ75767.1| 40S ribosomal protein S28 [Hirsutella minnesotensis 3608] Length = 68 Score = 107 bits (267), Expect = 3e-21 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = +2 Query: 53 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 220 MDS+K PVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDILC Sbjct: 1 MDSSKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >gb|KKA26499.1| hypothetical protein TD95_004483 [Thielaviopsis punctulata] Length = 68 Score = 107 bits (266), Expect = 4e-21 Identities = 53/56 (94%), Positives = 55/56 (98%) Frame = +2 Query: 53 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 220 M+SAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVRE+DILC Sbjct: 1 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDNTRSIIRNVKGPVRENDILC 56 >gb|KIW01680.1| 40S ribosomal protein S28 [Verruconis gallopava] Length = 68 Score = 106 bits (265), Expect = 5e-21 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +2 Query: 53 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 220 MD+AK P+KLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRE+DILC Sbjct: 1 MDTAKQPIKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 56 >gb|ERS99836.1| 40S ribosomal protein S28 [Sporothrix schenckii ATCC 58251] gi|748541462|gb|KIH91767.1| small subunit ribosomal protein S28e [Sporothrix brasiliensis 5110] gi|751356805|gb|KIL94527.1| 40s ribosomal protein s28 [Fusarium avenaceum] gi|780595120|gb|KJR85779.1| small subunit ribosomal protein S28e [Sporothrix schenckii 1099-18] Length = 68 Score = 106 bits (265), Expect = 5e-21 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = +2 Query: 53 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 220 MDS+K PVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDILC Sbjct: 1 MDSSKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56