BLASTX nr result
ID: Forsythia21_contig00033379
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00033379 (526 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001938519.1| 40S ribosomal protein S28 [Pyrenophora triti... 104 3e-20 ref|XP_002153086.1| 40S ribosomal protein S28 [Talaromyces marne... 103 3e-20 ref|XP_001798512.1| hypothetical protein SNOG_08190 [Phaeosphaer... 103 6e-20 ref|XP_003009124.1| 40S ribosomal protein S28 [Verticillium alfa... 102 8e-20 gb|EMR82428.1| putative 40s ribosomal protein s28 protein [Botry... 102 8e-20 ref|XP_007681584.1| hypothetical protein BAUCODRAFT_315059 [Baud... 102 8e-20 gb|KKF94527.1| 40S ribosomal protein S28 [Ceratocystis platani] 102 1e-19 ref|XP_003850653.1| 40S ribosomal protein S28 [Zymoseptoria trit... 101 2e-19 ref|XP_007827699.1| 40S ribosomal protein S28 [Pestalotiopsis fi... 101 2e-19 gb|KKA26499.1| hypothetical protein TD95_004483 [Thielaviopsis p... 101 2e-19 gb|KDB13252.1| IBR domain-containing protein [Ustilaginoidea vir... 101 2e-19 ref|XP_003000163.1| 40S ribosomal protein S28 [Verticillium alfa... 101 2e-19 ref|XP_960561.1| 40S ribosomal protein S28 [Neurospora crassa OR... 101 2e-19 ref|XP_007915668.1| putative 40s ribosomal protein s28 protein [... 101 2e-19 dbj|GAD98718.1| 40S ribosomal protein S28 [Byssochlamys spectabi... 100 3e-19 ref|XP_007582595.1| putative 40s ribosomal protein s28 protein [... 100 3e-19 ref|XP_007600844.1| 40S ribosomal protein S28 [Colletotrichum fi... 100 4e-19 gb|ERS99836.1| 40S ribosomal protein S28 [Sporothrix schenckii A... 100 4e-19 ref|XP_008085508.1| Nucleic acid-binding protein [Glarea lozoyen... 100 4e-19 ref|XP_007791611.1| putative 40s ribosomal protein s28 protein [... 100 4e-19 >ref|XP_001938519.1| 40S ribosomal protein S28 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|330933665|ref|XP_003304246.1| 40S ribosomal protein S28 [Pyrenophora teres f. teres 0-1] gi|627822740|ref|XP_007684196.1| hypothetical protein COCMIDRAFT_33356 [Bipolaris oryzae ATCC 44560] gi|628083058|ref|XP_007703379.1| hypothetical protein COCSADRAFT_98221 [Bipolaris sorokiniana ND90Pr] gi|628219562|ref|XP_007714597.1| hypothetical protein COCCADRAFT_6973 [Bipolaris zeicola 26-R-13] gi|636596717|ref|XP_008029697.1| hypothetical protein SETTUDRAFT_165088 [Setosphaeria turcica Et28A] gi|187985618|gb|EDU51106.1| 40S ribosomal protein S28 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|311319241|gb|EFQ87658.1| hypothetical protein PTT_16774 [Pyrenophora teres f. teres 0-1] gi|451847735|gb|EMD61042.1| hypothetical protein COCSADRAFT_98221 [Bipolaris sorokiniana ND90Pr] gi|451996807|gb|EMD89273.1| hypothetical protein COCHEDRAFT_1141328 [Bipolaris maydis C5] gi|477587930|gb|ENI05010.1| hypothetical protein COCC4DRAFT_138898 [Bipolaris maydis ATCC 48331] gi|482805519|gb|EOA82605.1| hypothetical protein SETTUDRAFT_165088 [Setosphaeria turcica Et28A] gi|576916842|gb|EUC31086.1| hypothetical protein COCCADRAFT_6973 [Bipolaris zeicola 26-R-13] gi|576935802|gb|EUC49303.1| hypothetical protein COCMIDRAFT_33356 [Bipolaris oryzae ATCC 44560] gi|578488046|gb|EUN25495.1| hypothetical protein COCVIDRAFT_103321 [Bipolaris victoriae FI3] Length = 68 Score = 104 bits (259), Expect = 3e-20 Identities = 51/54 (94%), Positives = 53/54 (98%) Frame = -1 Query: 448 MESAKVPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVREDDI 287 M+SAK PVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVRE+DI Sbjct: 1 MDSAKAPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVRENDI 54 >ref|XP_002153086.1| 40S ribosomal protein S28 [Talaromyces marneffei ATCC 18224] gi|242820646|ref|XP_002487548.1| 40S ribosomal protein S28 [Talaromyces stipitatus ATCC 10500] gi|242820650|ref|XP_002487549.1| 40S ribosomal protein S28 [Talaromyces stipitatus ATCC 10500] gi|210064606|gb|EEA18701.1| Ribosomal protein S28e [Talaromyces marneffei ATCC 18224] gi|218714013|gb|EED13437.1| Ribosomal protein S28e [Talaromyces stipitatus ATCC 10500] gi|218714014|gb|EED13438.1| Ribosomal protein S28e [Talaromyces stipitatus ATCC 10500] gi|680000722|gb|KFX52824.1| 40S ribosomal protein S28 [Talaromyces marneffei PM1] gi|748550736|dbj|GAM43411.1| ribosomal protein [Talaromyces cellulolyticus] gi|816186318|emb|CRG91631.1| hypothetical protein PISL3812_08681 [Talaromyces islandicus] Length = 68 Score = 103 bits (258), Expect = 3e-20 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = -1 Query: 448 MESAKVPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVREDDI 287 M+SAKVPVKLVKVTRVLGRTGSRGGVTQ RVEFMDDQTRSIIRNVKGPVREDDI Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDI 54 >ref|XP_001798512.1| hypothetical protein SNOG_08190 [Phaeosphaeria nodorum SN15] gi|396459705|ref|XP_003834465.1| hypothetical protein LEMA_P061340.1 [Leptosphaeria maculans JN3] gi|111063346|gb|EAT84466.1| hypothetical protein SNOG_08190 [Phaeosphaeria nodorum SN15] gi|312211014|emb|CBX91100.1| hypothetical protein LEMA_P061340.1 [Leptosphaeria maculans JN3] Length = 68 Score = 103 bits (256), Expect = 6e-20 Identities = 50/54 (92%), Positives = 53/54 (98%) Frame = -1 Query: 448 MESAKVPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVREDDI 287 M++AK PVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVRE+DI Sbjct: 1 MDTAKAPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVRENDI 54 >ref|XP_003009124.1| 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] gi|697069809|ref|XP_009650088.1| hypothetical protein VDAG_00416 [Verticillium dahliae VdLs.17] gi|261352270|gb|EEY14698.1| 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] gi|346970282|gb|EGY13734.1| hypothetical protein VDAG_00416 [Verticillium dahliae VdLs.17] Length = 68 Score = 102 bits (255), Expect = 8e-20 Identities = 51/54 (94%), Positives = 53/54 (98%) Frame = -1 Query: 448 MESAKVPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVREDDI 287 M+S+KVPVKLVKVTRVLGRTGSRGGVTQ RVEFMDDQTRSIIRNVKGPVREDDI Sbjct: 1 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDI 54 >gb|EMR82428.1| putative 40s ribosomal protein s28 protein [Botrytis cinerea BcDW1] Length = 114 Score = 102 bits (255), Expect = 8e-20 Identities = 53/64 (82%), Positives = 55/64 (85%) Frame = -1 Query: 478 KSSNF*QQVKMESAKVPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVR 299 KS KME++KVPVKLVKVTRVLGRTGSRGGVTQ RVEFMDD TRSIIRNVKGPVR Sbjct: 37 KSKRINPIAKMEASKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVR 96 Query: 298 EDDI 287 EDDI Sbjct: 97 EDDI 100 >ref|XP_007681584.1| hypothetical protein BAUCODRAFT_315059 [Baudoinia compniacensis UAMH 10762] gi|449295094|gb|EMC91116.1| hypothetical protein BAUCODRAFT_315059 [Baudoinia compniacensis UAMH 10762] gi|662503260|gb|KEQ60881.1| ribosomal protein S28e [Aureobasidium melanogenum CBS 110374] gi|662518527|gb|KEQ76087.1| ribosomal protein S28e [Aureobasidium namibiae CBS 147.97] gi|662527623|gb|KEQ85002.1| ribosomal protein S28e [Aureobasidium pullulans EXF-150] Length = 68 Score = 102 bits (255), Expect = 8e-20 Identities = 52/54 (96%), Positives = 52/54 (96%) Frame = -1 Query: 448 MESAKVPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVREDDI 287 MESAKVPVKLVKVTRVLGRTGSRGGVTQ RVEFMDD TRSIIRNVKGPVREDDI Sbjct: 1 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >gb|KKF94527.1| 40S ribosomal protein S28 [Ceratocystis platani] Length = 68 Score = 102 bits (253), Expect = 1e-19 Identities = 52/54 (96%), Positives = 52/54 (96%) Frame = -1 Query: 448 MESAKVPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVREDDI 287 MESAKV VKLVKVTRVLGRTGSRGGVTQ RVEFMDDQTRSIIRNVKGPVREDDI Sbjct: 1 MESAKVQVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDI 54 >ref|XP_003850653.1| 40S ribosomal protein S28 [Zymoseptoria tritici IPO323] gi|631388890|ref|XP_007928825.1| hypothetical protein MYCFIDRAFT_49708 [Pseudocercospora fijiensis CIRAD86] gi|339470532|gb|EGP85629.1| hypothetical protein MYCGRDRAFT_81501 [Zymoseptoria tritici IPO323] gi|452980191|gb|EME79952.1| hypothetical protein MYCFIDRAFT_49708 [Pseudocercospora fijiensis CIRAD86] gi|752275464|dbj|GAM89234.1| hypothetical protein ANO11243_072710 [fungal sp. No.11243] gi|796706002|gb|KJX97506.1| 40s ribosomal protein s28 [Zymoseptoria brevis] Length = 68 Score = 101 bits (252), Expect = 2e-19 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = -1 Query: 448 MESAKVPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVREDDI 287 M+SAKVPVKLVKVTRVLGRTGSRGGVTQ RVEFMDD TRSIIRNVKGPVREDDI Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >ref|XP_007827699.1| 40S ribosomal protein S28 [Pestalotiopsis fici W106-1] gi|827075690|ref|XP_008099256.1| ribosomal protein S28e [Colletotrichum graminicola M1.001] gi|310800343|gb|EFQ35236.1| ribosomal protein S28e [Colletotrichum graminicola M1.001] gi|380474013|emb|CCF46007.1| 40S ribosomal protein S28 [Colletotrichum higginsianum] gi|573067571|gb|ETS87099.1| 40S ribosomal protein S28 [Pestalotiopsis fici W106-1] gi|640921526|gb|KDN65874.1| putative 40S ribosomal protein S28 [Colletotrichum sublineola] Length = 68 Score = 101 bits (252), Expect = 2e-19 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = -1 Query: 448 MESAKVPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVREDDI 287 M+SAK PVKLVKVTRVLGRTGSRGGVTQ RVEFMDDQTRSIIRNVKGPVREDDI Sbjct: 1 MDSAKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDI 54 >gb|KKA26499.1| hypothetical protein TD95_004483 [Thielaviopsis punctulata] Length = 68 Score = 101 bits (251), Expect = 2e-19 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = -1 Query: 448 MESAKVPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVREDDI 287 MESAKVPVKLVKVTRVLGRTGSRGGVTQ RVEFMDD TRSIIRNVKGPVRE+DI Sbjct: 1 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDNTRSIIRNVKGPVRENDI 54 >gb|KDB13252.1| IBR domain-containing protein [Ustilaginoidea virens] Length = 480 Score = 101 bits (251), Expect = 2e-19 Identities = 50/54 (92%), Positives = 52/54 (96%) Frame = -1 Query: 448 MESAKVPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVREDDI 287 M+S+K PVKLVKVTRVLGRTGSRGGVTQ RVEFMDDQTRSIIRNVKGPVREDDI Sbjct: 413 MDSSKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDI 466 >ref|XP_003000163.1| 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] gi|697076619|ref|XP_009652495.1| 40S ribosomal protein S28 [Verticillium dahliae VdLs.17] gi|261360820|gb|EEY23248.1| 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] gi|346979706|gb|EGY23158.1| 40S ribosomal protein S28 [Verticillium dahliae VdLs.17] gi|729185410|emb|CEJ91264.1| Putative 40S ribosomal protein S28 [Torrubiella hemipterigena] Length = 68 Score = 101 bits (251), Expect = 2e-19 Identities = 50/54 (92%), Positives = 52/54 (96%) Frame = -1 Query: 448 MESAKVPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVREDDI 287 M+S+K PVKLVKVTRVLGRTGSRGGVTQ RVEFMDDQTRSIIRNVKGPVREDDI Sbjct: 1 MDSSKTPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDI 54 >ref|XP_960561.1| 40S ribosomal protein S28 [Neurospora crassa OR74A] gi|336276482|ref|XP_003352994.1| 40S ribosomal protein S28 [Sordaria macrospora k-hell] gi|698994490|ref|XP_009854226.1| hypothetical protein NEUTE1DRAFT_118111 [Neurospora tetrasperma FGSC 2508] gi|51316762|sp|Q7S6W5.1|RS28_NEUCR RecName: Full=40S ribosomal protein S28 gi|28922054|gb|EAA31325.1| 40S ribosomal protein S28 [Neurospora crassa OR74A] gi|336466085|gb|EGO54250.1| hypothetical protein NEUTE1DRAFT_118111 [Neurospora tetrasperma FGSC 2508] gi|350287069|gb|EGZ68316.1| ribosomal protein S28e [Neurospora tetrasperma FGSC 2509] gi|380092479|emb|CCC09756.1| unnamed protein product [Sordaria macrospora k-hell] gi|725983750|gb|KHE86754.1| hypothetical protein GE21DRAFT_8916 [Neurospora crassa] Length = 68 Score = 101 bits (251), Expect = 2e-19 Identities = 50/54 (92%), Positives = 52/54 (96%) Frame = -1 Query: 448 MESAKVPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVREDDI 287 M+S+K PVKLVKVTRVLGRTGSRGGVTQ RVEFMDDQTRSIIRNVKGPVREDDI Sbjct: 1 MDSSKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDI 54 >ref|XP_007915668.1| putative 40s ribosomal protein s28 protein [Togninia minima UCRPA7] gi|399165856|emb|CCE33319.1| probable ribosomal protein S28B [Claviceps purpurea 20.1] gi|500256292|gb|EON99563.1| putative 40s ribosomal protein s28 protein [Togninia minima UCRPA7] gi|594720915|gb|EXV03803.1| ribosomal protein S28e [Metarhizium robertsii] gi|672383491|gb|KFG85603.1| 40S ribosomal protein S28 [Metarhizium anisopliae] gi|743638615|gb|KID69986.1| Ribosomal protein S28e, partial [Metarhizium anisopliae ARSEF 549] gi|743641156|gb|KID72508.1| Ribosomal protein S28e, partial [Metarhizium brunneum ARSEF 3297] gi|743662232|gb|KID89430.1| Ribosomal protein S28e [Metarhizium guizhouense ARSEF 977] gi|770389641|gb|KJK75639.1| hypothetical protein H634G_09003 [Metarhizium anisopliae BRIP 53293] gi|770409186|gb|KJK93999.1| hypothetical protein H633G_02099 [Metarhizium anisopliae BRIP 53284] gi|799246995|gb|KJZ75767.1| 40S ribosomal protein S28 [Hirsutella minnesotensis 3608] Length = 68 Score = 101 bits (251), Expect = 2e-19 Identities = 50/54 (92%), Positives = 52/54 (96%) Frame = -1 Query: 448 MESAKVPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVREDDI 287 M+S+K PVKLVKVTRVLGRTGSRGGVTQ RVEFMDDQTRSIIRNVKGPVREDDI Sbjct: 1 MDSSKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDI 54 >dbj|GAD98718.1| 40S ribosomal protein S28 [Byssochlamys spectabilis No. 5] Length = 68 Score = 100 bits (250), Expect = 3e-19 Identities = 50/54 (92%), Positives = 52/54 (96%) Frame = -1 Query: 448 MESAKVPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVREDDI 287 MESAK PVKLVKVTRVLGRTGSRGGVTQ RVEFMDDQ+RSIIRNVKGPVR+DDI Sbjct: 1 MESAKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQSRSIIRNVKGPVRQDDI 54 >ref|XP_007582595.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] gi|615415585|ref|XP_007584949.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] gi|485922014|gb|EOD47615.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] gi|485925270|gb|EOD49893.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] Length = 68 Score = 100 bits (250), Expect = 3e-19 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = -1 Query: 448 MESAKVPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVREDDI 287 MESAKVPVKLVKVTRVLGRTGSRGGVTQ RVEFMDD TRSIIRNVKGPVRE+DI Sbjct: 1 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI 54 >ref|XP_007600844.1| 40S ribosomal protein S28 [Colletotrichum fioriniae PJ7] gi|588893325|gb|EXF75473.1| 40S ribosomal protein S28 [Colletotrichum fioriniae PJ7] Length = 68 Score = 100 bits (249), Expect = 4e-19 Identities = 50/54 (92%), Positives = 52/54 (96%) Frame = -1 Query: 448 MESAKVPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVREDDI 287 M+SAK PVKLVKVTRVLGRTGSRGGVTQ RVEFMDD+TRSIIRNVKGPVREDDI Sbjct: 1 MDSAKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDETRSIIRNVKGPVREDDI 54 >gb|ERS99836.1| 40S ribosomal protein S28 [Sporothrix schenckii ATCC 58251] gi|748541462|gb|KIH91767.1| small subunit ribosomal protein S28e [Sporothrix brasiliensis 5110] gi|751356805|gb|KIL94527.1| 40s ribosomal protein s28 [Fusarium avenaceum] gi|780595120|gb|KJR85779.1| small subunit ribosomal protein S28e [Sporothrix schenckii 1099-18] Length = 68 Score = 100 bits (249), Expect = 4e-19 Identities = 50/54 (92%), Positives = 52/54 (96%) Frame = -1 Query: 448 MESAKVPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVREDDI 287 M+S+K PVKLVKVTRVLGRTGSRGGVTQ RVEFMDDQTRSIIRNVKGPVREDDI Sbjct: 1 MDSSKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDI 54 >ref|XP_008085508.1| Nucleic acid-binding protein [Glarea lozoyensis ATCC 20868] gi|512199315|gb|EPE28149.1| Nucleic acid-binding protein [Glarea lozoyensis ATCC 20868] gi|751749436|gb|KIM97619.1| hypothetical protein OIDMADRAFT_20164 [Oidiodendron maius Zn] Length = 68 Score = 100 bits (249), Expect = 4e-19 Identities = 50/54 (92%), Positives = 52/54 (96%) Frame = -1 Query: 448 MESAKVPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVREDDI 287 M+S+KVPVKLVKVTRVLGRTGSRGGVTQ RVEFMDD TRSIIRNVKGPVREDDI Sbjct: 1 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >ref|XP_007791611.1| putative 40s ribosomal protein s28 protein [Eutypa lata UCREL1] gi|471570085|gb|EMR69305.1| putative 40s ribosomal protein s28 protein [Eutypa lata UCREL1] Length = 68 Score = 100 bits (249), Expect = 4e-19 Identities = 50/54 (92%), Positives = 52/54 (96%) Frame = -1 Query: 448 MESAKVPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVREDDI 287 M+SAK PVKLV+VTRVLGRTGSRGGVTQ RVEFMDDQTRSIIRNVKGPVREDDI Sbjct: 1 MDSAKQPVKLVRVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDI 54