BLASTX nr result
ID: Forsythia21_contig00033213
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00033213 (290 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008025187.1| hypothetical protein SETTUDRAFT_162779 [Seto... 65 2e-08 ref|XP_001940651.1| 60S ribosomal protein L34 [Pyrenophora triti... 65 2e-08 gb|EMD88396.1| hypothetical protein COCHEDRAFT_1141965, partial ... 62 1e-07 ref|XP_007688076.1| hypothetical protein COCMIDRAFT_26405 [Bipol... 62 1e-07 ref|XP_003834612.1| hypothetical protein LEMA_P067550.1 [Leptosp... 62 1e-07 ref|XP_001791136.1| hypothetical protein SNOG_00451 [Phaeosphaer... 62 1e-07 ref|XP_749439.1| ribosomal protein L34 protein [Aspergillus fumi... 61 3e-07 ref|XP_001265868.1| 60S ribosomal protein L34 [Neosartorya fisch... 61 3e-07 ref|XP_001272908.1| ribosomal protein L34 protein, putative [Asp... 61 3e-07 gb|KIW89839.1| hypothetical protein Z519_09268 [Cladophialophora... 61 3e-07 gb|KIW70413.1| hypothetical protein PV04_02685 [Capronia semiimm... 61 3e-07 gb|KIW40670.1| 60S ribosomal protein L34-B [Exophiala oligosperma] 61 3e-07 gb|KIW19070.1| 60S ribosomal protein L34-B [Exophiala spinifera] 61 3e-07 gb|KIV82393.1| 60S ribosomal protein L34-B [Exophiala sideris] 61 3e-07 gb|KIN04283.1| hypothetical protein OIDMADRAFT_18280 [Oidiodendr... 61 3e-07 gb|KIH92716.1| large subunit ribosomal protein L34e [Sporothrix ... 61 3e-07 gb|KHJ33100.1| putative 60s ribosomal protein l34 [Erysiphe neca... 61 3e-07 gb|KFY28724.1| hypothetical protein V493_02784 [Pseudogymnoascus... 61 3e-07 ref|XP_002379313.1| 60S ribosomal protein L34 [Aspergillus flavu... 61 3e-07 dbj|BAE60073.1| unnamed protein product [Aspergillus oryzae RIB40] 61 3e-07 >ref|XP_008025187.1| hypothetical protein SETTUDRAFT_162779 [Setosphaeria turcica Et28A] gi|482809703|gb|EOA86509.1| hypothetical protein SETTUDRAFT_162779 [Setosphaeria turcica Et28A] Length = 114 Score = 64.7 bits (156), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 290 SRPKKTVQRAYGGSRCAGCVQDRIVRAFLI 201 SRPKKTVQRAYGGSRCAGCVQDRIVRAFLI Sbjct: 67 SRPKKTVQRAYGGSRCAGCVQDRIVRAFLI 96 >ref|XP_001940651.1| 60S ribosomal protein L34 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|330928003|ref|XP_003302089.1| 60S ribosomal protein L34 [Pyrenophora teres f. teres 0-1] gi|187976744|gb|EDU43370.1| 60S ribosomal protein L34-B [Pyrenophora tritici-repentis Pt-1C-BFP] gi|311322747|gb|EFQ89813.1| hypothetical protein PTT_13782 [Pyrenophora teres f. teres 0-1] Length = 114 Score = 64.7 bits (156), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 290 SRPKKTVQRAYGGSRCAGCVQDRIVRAFLI 201 SRPKKTVQRAYGGSRCAGCVQDRIVRAFLI Sbjct: 67 SRPKKTVQRAYGGSRCAGCVQDRIVRAFLI 96 >gb|EMD88396.1| hypothetical protein COCHEDRAFT_1141965, partial [Bipolaris maydis C5] gi|477583667|gb|ENI00764.1| hypothetical protein COCC4DRAFT_149701 [Bipolaris maydis ATCC 48331] Length = 114 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 290 SRPKKTVQRAYGGSRCAGCVQDRIVRAFLI 201 SRPKKTVQRAYGGSRCA CVQDRIVRAFLI Sbjct: 67 SRPKKTVQRAYGGSRCANCVQDRIVRAFLI 96 >ref|XP_007688076.1| hypothetical protein COCMIDRAFT_26405 [Bipolaris oryzae ATCC 44560] gi|628070187|ref|XP_007699747.1| hypothetical protein COCSADRAFT_36616 [Bipolaris sorokiniana ND90Pr] gi|628211570|ref|XP_007713280.1| hypothetical protein COCCADRAFT_37637 [Bipolaris zeicola 26-R-13] gi|451850735|gb|EMD64036.1| hypothetical protein COCSADRAFT_36616 [Bipolaris sorokiniana ND90Pr] gi|576918189|gb|EUC32391.1| hypothetical protein COCCADRAFT_37637 [Bipolaris zeicola 26-R-13] gi|576931827|gb|EUC45380.1| hypothetical protein COCMIDRAFT_26405 [Bipolaris oryzae ATCC 44560] gi|578490392|gb|EUN27808.1| hypothetical protein COCVIDRAFT_97298 [Bipolaris victoriae FI3] Length = 114 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 290 SRPKKTVQRAYGGSRCAGCVQDRIVRAFLI 201 SRPKKTVQRAYGGSRCA CVQDRIVRAFLI Sbjct: 67 SRPKKTVQRAYGGSRCANCVQDRIVRAFLI 96 >ref|XP_003834612.1| hypothetical protein LEMA_P067550.1 [Leptosphaeria maculans JN3] gi|312211162|emb|CBX91247.1| hypothetical protein LEMA_P067550.1 [Leptosphaeria maculans JN3] Length = 165 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 290 SRPKKTVQRAYGGSRCAGCVQDRIVRAFLI 201 SRPKKTVQRAYGGSRCA CVQDRIVRAFLI Sbjct: 118 SRPKKTVQRAYGGSRCANCVQDRIVRAFLI 147 >ref|XP_001791136.1| hypothetical protein SNOG_00451 [Phaeosphaeria nodorum SN15] gi|111070826|gb|EAT91946.1| hypothetical protein SNOG_00451 [Phaeosphaeria nodorum SN15] Length = 114 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 290 SRPKKTVQRAYGGSRCAGCVQDRIVRAFLI 201 SRPKKTVQRAYGGSRCA CVQDRIVRAFLI Sbjct: 67 SRPKKTVQRAYGGSRCANCVQDRIVRAFLI 96 >ref|XP_749439.1| ribosomal protein L34 protein [Aspergillus fumigatus Af293] gi|66847070|gb|EAL87401.1| ribosomal protein L34 protein, putative [Aspergillus fumigatus Af293] gi|159128850|gb|EDP53964.1| ribosomal protein L34 protein, putative [Aspergillus fumigatus A1163] gi|666427857|gb|KEY75514.1| ribosomal protein L34 protein [Aspergillus fumigatus var. RP-2014] Length = 192 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 290 SRPKKTVQRAYGGSRCAGCVQDRIVRAFLI 201 SRPKKTV RAYGGSRCAGCV+DRIVRAFLI Sbjct: 142 SRPKKTVSRAYGGSRCAGCVKDRIVRAFLI 171 >ref|XP_001265868.1| 60S ribosomal protein L34 [Neosartorya fischeri NRRL 181] gi|119414032|gb|EAW23971.1| ribosomal protein L34 protein, putative [Neosartorya fischeri NRRL 181] gi|846911805|gb|KMK57673.1| ribosomal protein L34 protein, putative [Aspergillus fumigatus Z5] gi|849266679|dbj|GAO90737.1| 60S ribosomal protein L34-B [Neosartorya udagawae] Length = 117 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 290 SRPKKTVQRAYGGSRCAGCVQDRIVRAFLI 201 SRPKKTV RAYGGSRCAGCV+DRIVRAFLI Sbjct: 67 SRPKKTVSRAYGGSRCAGCVKDRIVRAFLI 96 >ref|XP_001272908.1| ribosomal protein L34 protein, putative [Aspergillus clavatus NRRL 1] gi|119401058|gb|EAW11482.1| ribosomal protein L34 protein, putative [Aspergillus clavatus NRRL 1] Length = 185 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 290 SRPKKTVQRAYGGSRCAGCVQDRIVRAFLI 201 SRPKKTV RAYGGSRCAGCV+DRIVRAFLI Sbjct: 135 SRPKKTVSRAYGGSRCAGCVKDRIVRAFLI 164 >gb|KIW89839.1| hypothetical protein Z519_09268 [Cladophialophora bantiana CBS 173.52] Length = 170 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 290 SRPKKTVQRAYGGSRCAGCVQDRIVRAFLI 201 SRPKKTVQRAYGGSRCA CV+DRIVRAFLI Sbjct: 120 SRPKKTVQRAYGGSRCANCVRDRIVRAFLI 149 >gb|KIW70413.1| hypothetical protein PV04_02685 [Capronia semiimmersa] Length = 117 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 290 SRPKKTVQRAYGGSRCAGCVQDRIVRAFLI 201 SRPKKTVQRAYGGSRCA CV+DRIVRAFLI Sbjct: 67 SRPKKTVQRAYGGSRCANCVRDRIVRAFLI 96 >gb|KIW40670.1| 60S ribosomal protein L34-B [Exophiala oligosperma] Length = 116 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 290 SRPKKTVQRAYGGSRCAGCVQDRIVRAFLI 201 SRPKKTVQRAYGGSRCA CV+DRIVRAFLI Sbjct: 67 SRPKKTVQRAYGGSRCANCVRDRIVRAFLI 96 >gb|KIW19070.1| 60S ribosomal protein L34-B [Exophiala spinifera] Length = 116 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 290 SRPKKTVQRAYGGSRCAGCVQDRIVRAFLI 201 SRPKKTVQRAYGGSRCA CV+DRIVRAFLI Sbjct: 67 SRPKKTVQRAYGGSRCANCVRDRIVRAFLI 96 >gb|KIV82393.1| 60S ribosomal protein L34-B [Exophiala sideris] Length = 117 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 290 SRPKKTVQRAYGGSRCAGCVQDRIVRAFLI 201 SRPKKTVQRAYGGSRCA CV+DRIVRAFLI Sbjct: 67 SRPKKTVQRAYGGSRCANCVKDRIVRAFLI 96 >gb|KIN04283.1| hypothetical protein OIDMADRAFT_18280 [Oidiodendron maius Zn] Length = 114 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 290 SRPKKTVQRAYGGSRCAGCVQDRIVRAFLI 201 SRPKKTVQRAYGGSRCA CV+DRIVRAFLI Sbjct: 67 SRPKKTVQRAYGGSRCANCVRDRIVRAFLI 96 >gb|KIH92716.1| large subunit ribosomal protein L34e [Sporothrix brasiliensis 5110] Length = 116 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 290 SRPKKTVQRAYGGSRCAGCVQDRIVRAFLI 201 S+PKKTVQRAYGGSRCA CVQDR+VRAFLI Sbjct: 67 SKPKKTVQRAYGGSRCANCVQDRVVRAFLI 96 >gb|KHJ33100.1| putative 60s ribosomal protein l34 [Erysiphe necator] Length = 113 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 290 SRPKKTVQRAYGGSRCAGCVQDRIVRAFLI 201 SRPKKTVQRAYGGSRCA CV+DRIVRAFLI Sbjct: 67 SRPKKTVQRAYGGSRCASCVRDRIVRAFLI 96 >gb|KFY28724.1| hypothetical protein V493_02784 [Pseudogymnoascus pannorum VKM F-4281 (FW-2241)] Length = 113 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 290 SRPKKTVQRAYGGSRCAGCVQDRIVRAFLI 201 SRPKKTVQRAYGGSRCA CV+DRIVRAFLI Sbjct: 67 SRPKKTVQRAYGGSRCANCVRDRIVRAFLI 96 >ref|XP_002379313.1| 60S ribosomal protein L34 [Aspergillus flavus NRRL3357] gi|317147350|ref|XP_001822075.2| 60S ribosomal protein L34 [Aspergillus oryzae RIB40] gi|220694193|gb|EED50537.1| ribosomal protein L34 protein, putative [Aspergillus flavus NRRL3357] gi|770301984|gb|KJK60282.1| hypothetical protein P875_00053504 [Aspergillus parasiticus SU-1] Length = 117 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 290 SRPKKTVQRAYGGSRCAGCVQDRIVRAFLI 201 SRPKKTV RAYGGSRCAGCV+DRIVRAFLI Sbjct: 67 SRPKKTVTRAYGGSRCAGCVKDRIVRAFLI 96 >dbj|BAE60073.1| unnamed protein product [Aspergillus oryzae RIB40] Length = 116 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 290 SRPKKTVQRAYGGSRCAGCVQDRIVRAFLI 201 SRPKKTV RAYGGSRCAGCV+DRIVRAFLI Sbjct: 66 SRPKKTVTRAYGGSRCAGCVKDRIVRAFLI 95