BLASTX nr result
ID: Forsythia21_contig00033174
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00033174 (213 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011085269.1| PREDICTED: probable purine permease 10 [Sesa... 49 1e-06 >ref|XP_011085269.1| PREDICTED: probable purine permease 10 [Sesamum indicum] Length = 346 Score = 48.5 bits (114), Expect(2) = 1e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = +2 Query: 2 VYIFLGLLQSAANVLYAVGLLNLPDSTFSLI 94 VYIFLGL Q+A VLY+VGL NLP STFSLI Sbjct: 100 VYIFLGLFQAATGVLYSVGLQNLPVSTFSLI 130 Score = 30.0 bits (66), Expect(2) = 1e-06 Identities = 18/31 (58%), Positives = 22/31 (70%) Frame = +3 Query: 120 LHSLSFSMHKS*TSLILNSLVLLTISAALLV 212 L S F+ K T LILNS+VLLTIS+ LL+ Sbjct: 140 LFSFFFNAQKL-TPLILNSVVLLTISSTLLI 169