BLASTX nr result
ID: Forsythia21_contig00033118
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00033118 (274 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAO85504.1| hypothetical protein AUD_4464 [Neosartorya udaga... 81 3e-13 ref|XP_660558.1| hypothetical protein AN2954.2 [Aspergillus nidu... 80 7e-13 ref|XP_002373631.1| extracellular serine-rich protein, putative ... 78 2e-12 dbj|BAE56403.1| unnamed protein product [Aspergillus oryzae RIB40] 78 2e-12 ref|XP_001818405.2| extracellular serine-rich protein [Aspergill... 78 2e-12 ref|XP_001270803.1| conserved hypothetical protein [Aspergillus ... 78 2e-12 gb|KKK19527.1| hypothetical protein AOCH_007249 [Aspergillus och... 78 3e-12 gb|KKK15354.1| hypothetical protein ARAM_003551 [Aspergillus ram... 78 3e-12 ref|XP_001263655.1| hypothetical protein NFIA_069290 [Neosartory... 78 3e-12 ref|XP_001209040.1| conserved hypothetical protein [Aspergillus ... 77 3e-12 gb|KMK60565.1| extracellular serine-rich protein, putative [Aspe... 77 5e-12 emb|CRG88281.1| hypothetical protein PISL3812_05310 [Talaromyces... 77 5e-12 gb|KEY82529.1| hypothetical protein extracellular serine rich [A... 77 5e-12 gb|EDP52952.1| extracellular serine-rich protein, putative [Aspe... 77 5e-12 ref|XP_754826.2| extracellular serine-rich protein [Aspergillus ... 77 5e-12 gb|KKA19086.1| hypothetical protein T310_6964 [Rasamsonia emerso... 77 6e-12 gb|KKY31529.1| putative extracellular serine-rich [Diaporthe amp... 74 4e-11 gb|AFU51798.1| hypothetical protein [Penicillium decumbens] gi|5... 74 4e-11 ref|XP_007803303.1| hypothetical protein EPUS_03288 [Endocarpon ... 73 7e-11 emb|CEJ56959.1| Putative Extracellular serine-rich protein [Peni... 72 1e-10 >dbj|GAO85504.1| hypothetical protein AUD_4464 [Neosartorya udagawae] Length = 770 Score = 80.9 bits (198), Expect = 3e-13 Identities = 40/55 (72%), Positives = 44/55 (80%) Frame = -3 Query: 167 GNIGSTILVIADDSTSASVAARGLNGYGIPYETLLVPQSGVTLPTLNSSGTGNYG 3 G++ S ILVIA DS+SAS A GLN YGIPY TLLVPQ+GVTLP LNSS GNYG Sbjct: 107 GSVLSNILVIAKDSSSASSATSGLNAYGIPYTTLLVPQAGVTLPALNSSNVGNYG 161 >ref|XP_660558.1| hypothetical protein AN2954.2 [Aspergillus nidulans FGSC A4] gi|40744349|gb|EAA63525.1| hypothetical protein AN2954.2 [Aspergillus nidulans FGSC A4] gi|259486104|tpe|CBF83680.1| TPA: extracellular serine-rich protein, putative (AFU_orthologue; AFUA_3G07870) [Aspergillus nidulans FGSC A4] Length = 912 Score = 79.7 bits (195), Expect = 7e-13 Identities = 38/56 (67%), Positives = 46/56 (82%) Frame = -3 Query: 170 SGNIGSTILVIADDSTSASVAARGLNGYGIPYETLLVPQSGVTLPTLNSSGTGNYG 3 +G++ + ILVIA DST ASVA+ GLNGYGIP+ TLLVPQ+GV LP LNSS GN+G Sbjct: 249 TGSLANNILVIARDSTQASVASSGLNGYGIPFTTLLVPQAGVELPALNSSSGGNFG 304 >ref|XP_002373631.1| extracellular serine-rich protein, putative [Aspergillus flavus NRRL3357] gi|220701681|gb|EED58019.1| extracellular serine-rich protein, putative [Aspergillus flavus NRRL3357] gi|391870579|gb|EIT79759.1| extracellular serine-rich protein, putative [Aspergillus oryzae 3.042] gi|635507864|gb|KDE79861.1| extracellular serine-rich protein, putative [Aspergillus oryzae 100-8] Length = 794 Score = 78.2 bits (191), Expect = 2e-12 Identities = 36/56 (64%), Positives = 44/56 (78%) Frame = -3 Query: 170 SGNIGSTILVIADDSTSASVAARGLNGYGIPYETLLVPQSGVTLPTLNSSGTGNYG 3 +GN+ ILVIA D+ +A+VA GLNGYGIP+ TLLVPQSGVTLP LN + GN+G Sbjct: 133 NGNVAGNILVIAKDTAAANVATSGLNGYGIPFTTLLVPQSGVTLPELNGTSGGNFG 188 >dbj|BAE56403.1| unnamed protein product [Aspergillus oryzae RIB40] Length = 685 Score = 78.2 bits (191), Expect = 2e-12 Identities = 36/56 (64%), Positives = 44/56 (78%) Frame = -3 Query: 170 SGNIGSTILVIADDSTSASVAARGLNGYGIPYETLLVPQSGVTLPTLNSSGTGNYG 3 +GN+ ILVIA D+ +A+VA GLNGYGIP+ TLLVPQSGVTLP LN + GN+G Sbjct: 24 NGNVAGNILVIAKDTAAANVATSGLNGYGIPFTTLLVPQSGVTLPELNGTSGGNFG 79 >ref|XP_001818405.2| extracellular serine-rich protein [Aspergillus oryzae RIB40] Length = 794 Score = 78.2 bits (191), Expect = 2e-12 Identities = 36/56 (64%), Positives = 44/56 (78%) Frame = -3 Query: 170 SGNIGSTILVIADDSTSASVAARGLNGYGIPYETLLVPQSGVTLPTLNSSGTGNYG 3 +GN+ ILVIA D+ +A+VA GLNGYGIP+ TLLVPQSGVTLP LN + GN+G Sbjct: 133 NGNVAGNILVIAKDTAAANVATSGLNGYGIPFTTLLVPQSGVTLPELNGTSGGNFG 188 >ref|XP_001270803.1| conserved hypothetical protein [Aspergillus clavatus NRRL 1] gi|119398949|gb|EAW09377.1| conserved hypothetical protein [Aspergillus clavatus NRRL 1] Length = 689 Score = 78.2 bits (191), Expect = 2e-12 Identities = 39/56 (69%), Positives = 47/56 (83%), Gaps = 1/56 (1%) Frame = -3 Query: 167 GNIGSTILVIADDSTSASVAARGLNGYGIPYETLLVPQSGV-TLPTLNSSGTGNYG 3 G++ S ILVIA D+T+ASVA+ GLNGYGIP+ TLLVPQSGV LP LNS+G GN+G Sbjct: 25 GSVSSNILVIARDATAASVASSGLNGYGIPFTTLLVPQSGVPALPALNSTGGGNFG 80 >gb|KKK19527.1| hypothetical protein AOCH_007249 [Aspergillus ochraceoroseus] Length = 789 Score = 77.8 bits (190), Expect = 3e-12 Identities = 38/56 (67%), Positives = 44/56 (78%) Frame = -3 Query: 170 SGNIGSTILVIADDSTSASVAARGLNGYGIPYETLLVPQSGVTLPTLNSSGTGNYG 3 +G I + ILVIA DS+ A VA+ GLN YGIP+ TLLVPQSGV LPTLNSS GN+G Sbjct: 129 TGTIAANILVIARDSSQAGVASSGLNAYGIPFTTLLVPQSGVQLPTLNSSSGGNFG 184 >gb|KKK15354.1| hypothetical protein ARAM_003551 [Aspergillus rambellii] Length = 791 Score = 77.8 bits (190), Expect = 3e-12 Identities = 38/56 (67%), Positives = 44/56 (78%) Frame = -3 Query: 170 SGNIGSTILVIADDSTSASVAARGLNGYGIPYETLLVPQSGVTLPTLNSSGTGNYG 3 +G I + ILVIA DS+ A VA+ GLN YGIP+ TLLVPQSGV LPTLNSS GN+G Sbjct: 131 TGTIAANILVIARDSSQAGVASSGLNAYGIPFTTLLVPQSGVQLPTLNSSSGGNFG 186 >ref|XP_001263655.1| hypothetical protein NFIA_069290 [Neosartorya fischeri NRRL 181] gi|119411815|gb|EAW21758.1| conserved hypothetical protein [Neosartorya fischeri NRRL 181] Length = 686 Score = 77.8 bits (190), Expect = 3e-12 Identities = 38/55 (69%), Positives = 43/55 (78%) Frame = -3 Query: 167 GNIGSTILVIADDSTSASVAARGLNGYGIPYETLLVPQSGVTLPTLNSSGTGNYG 3 G++ S ILVIA DS++AS A GLN YGIPY TLLVPQ+GV LP LNSS GNYG Sbjct: 23 GSVLSNILVIAKDSSAASSATSGLNAYGIPYTTLLVPQAGVALPALNSSNVGNYG 77 >ref|XP_001209040.1| conserved hypothetical protein [Aspergillus terreus NIH2624] gi|114196732|gb|EAU38432.1| conserved hypothetical protein [Aspergillus terreus NIH2624] Length = 811 Score = 77.4 bits (189), Expect = 3e-12 Identities = 38/55 (69%), Positives = 44/55 (80%) Frame = -3 Query: 167 GNIGSTILVIADDSTSASVAARGLNGYGIPYETLLVPQSGVTLPTLNSSGTGNYG 3 G++ + ILVIA DS SA VA+ GLNGYGIP+ TLLVPQSGV LP LNSS GN+G Sbjct: 88 GSVLANILVIARDSASAKVASSGLNGYGIPFTTLLVPQSGVQLPALNSSSGGNFG 142 >gb|KMK60565.1| extracellular serine-rich protein, putative [Aspergillus fumigatus Z5] Length = 786 Score = 77.0 bits (188), Expect = 5e-12 Identities = 38/55 (69%), Positives = 43/55 (78%) Frame = -3 Query: 167 GNIGSTILVIADDSTSASVAARGLNGYGIPYETLLVPQSGVTLPTLNSSGTGNYG 3 G++ S ILVIA DS++AS A GLN YGIPY TLLVPQ+GV LP LNSS GNYG Sbjct: 123 GSVLSNILVIAKDSSAASSATSGLNAYGIPYTTLLVPQAGVGLPALNSSNVGNYG 177 >emb|CRG88281.1| hypothetical protein PISL3812_05310 [Talaromyces islandicus] Length = 686 Score = 77.0 bits (188), Expect = 5e-12 Identities = 37/56 (66%), Positives = 45/56 (80%) Frame = -3 Query: 170 SGNIGSTILVIADDSTSASVAARGLNGYGIPYETLLVPQSGVTLPTLNSSGTGNYG 3 + ++ S ILVIA DS SA +A+ GLNGYGIP+ TLLVPQ+GV LP+LNSS GNYG Sbjct: 23 TASLESKILVIATDSASAKIASSGLNGYGIPFSTLLVPQAGVQLPSLNSSTGGNYG 78 >gb|KEY82529.1| hypothetical protein extracellular serine rich [Aspergillus fumigatus var. RP-2014] Length = 784 Score = 77.0 bits (188), Expect = 5e-12 Identities = 38/55 (69%), Positives = 43/55 (78%) Frame = -3 Query: 167 GNIGSTILVIADDSTSASVAARGLNGYGIPYETLLVPQSGVTLPTLNSSGTGNYG 3 G++ S ILVIA DS++AS A GLN YGIPY TLLVPQ+GV LP LNSS GNYG Sbjct: 121 GSVLSNILVIAKDSSAASSATSGLNAYGIPYTTLLVPQAGVGLPALNSSNVGNYG 175 >gb|EDP52952.1| extracellular serine-rich protein, putative [Aspergillus fumigatus A1163] Length = 781 Score = 77.0 bits (188), Expect = 5e-12 Identities = 38/55 (69%), Positives = 43/55 (78%) Frame = -3 Query: 167 GNIGSTILVIADDSTSASVAARGLNGYGIPYETLLVPQSGVTLPTLNSSGTGNYG 3 G++ S ILVIA DS++AS A GLN YGIPY TLLVPQ+GV LP LNSS GNYG Sbjct: 118 GSVLSNILVIAKDSSAASSATSGLNAYGIPYTTLLVPQAGVGLPALNSSNVGNYG 172 >ref|XP_754826.2| extracellular serine-rich protein [Aspergillus fumigatus Af293] gi|129558336|gb|EAL92788.2| extracellular serine-rich protein, putative [Aspergillus fumigatus Af293] Length = 801 Score = 77.0 bits (188), Expect = 5e-12 Identities = 38/55 (69%), Positives = 43/55 (78%) Frame = -3 Query: 167 GNIGSTILVIADDSTSASVAARGLNGYGIPYETLLVPQSGVTLPTLNSSGTGNYG 3 G++ S ILVIA DS++AS A GLN YGIPY TLLVPQ+GV LP LNSS GNYG Sbjct: 138 GSVLSNILVIAKDSSAASSATSGLNAYGIPYTTLLVPQAGVGLPALNSSNVGNYG 192 >gb|KKA19086.1| hypothetical protein T310_6964 [Rasamsonia emersonii CBS 393.64] Length = 700 Score = 76.6 bits (187), Expect = 6e-12 Identities = 37/56 (66%), Positives = 43/56 (76%) Frame = -3 Query: 170 SGNIGSTILVIADDSTSASVAARGLNGYGIPYETLLVPQSGVTLPTLNSSGTGNYG 3 + + STILVIA D++SA A GLNGYGIP+ TLLVPQSG TLP LNSS GN+G Sbjct: 33 ASTVQSTILVIARDNSSAQTATSGLNGYGIPFTTLLVPQSGTTLPPLNSSAGGNFG 88 >gb|KKY31529.1| putative extracellular serine-rich [Diaporthe ampelina] Length = 685 Score = 73.9 bits (180), Expect = 4e-11 Identities = 37/57 (64%), Positives = 44/57 (77%), Gaps = 1/57 (1%) Frame = -3 Query: 170 SGNIGSTILVIADDSTSASVAARGLNGYGIPYETLLVPQSGVTLPTLNSSGT-GNYG 3 + ++ +TILV A DS SA+VA GL GYGIPY+T+LVPQSG LP LNSS T GNYG Sbjct: 21 ANSVANTILVFARDSASANVATLGLQGYGIPYQTVLVPQSGAALPVLNSSTTQGNYG 77 >gb|AFU51798.1| hypothetical protein [Penicillium decumbens] gi|525580453|gb|EPS26703.1| hypothetical protein PDE_01641 [Penicillium oxalicum 114-2] Length = 798 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/53 (64%), Positives = 42/53 (79%) Frame = -3 Query: 161 IGSTILVIADDSTSASVAARGLNGYGIPYETLLVPQSGVTLPTLNSSGTGNYG 3 + + ILVIA D+ SASVA+ GLNGYGIP+ TL+VPQ+G LP LNSS GN+G Sbjct: 138 VANNILVIARDAASASVASSGLNGYGIPFTTLIVPQAGAPLPALNSSNAGNFG 190 >ref|XP_007803303.1| hypothetical protein EPUS_03288 [Endocarpon pusillum Z07020] gi|539434468|gb|ERF71009.1| hypothetical protein EPUS_03288 [Endocarpon pusillum Z07020] Length = 707 Score = 73.2 bits (178), Expect = 7e-11 Identities = 35/55 (63%), Positives = 40/55 (72%) Frame = -3 Query: 167 GNIGSTILVIADDSTSASVAARGLNGYGIPYETLLVPQSGVTLPTLNSSGTGNYG 3 GN + ILVIA D+ SA A G NGYGIPY TL+VPQ+G LP LN+SG GNYG Sbjct: 39 GNTKAEILVIARDAASARNLASGFNGYGIPYSTLVVPQAGTQLPALNTSGVGNYG 93 >emb|CEJ56959.1| Putative Extracellular serine-rich protein [Penicillium brasilianum] Length = 995 Score = 72.4 bits (176), Expect = 1e-10 Identities = 35/53 (66%), Positives = 41/53 (77%) Frame = -3 Query: 161 IGSTILVIADDSTSASVAARGLNGYGIPYETLLVPQSGVTLPTLNSSGTGNYG 3 I ILVIA D+ SA VA+ GLN YGIP+ TL+VPQSGVTLP LN+S GN+G Sbjct: 335 IAGNILVIARDTASAGVASSGLNAYGIPFTTLIVPQSGVTLPALNTSTGGNFG 387