BLASTX nr result
ID: Forsythia21_contig00032513
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00032513 (366 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB52158.1| hypothetical protein B456_008G248500 [Gossypium r... 58 3e-06 >gb|KJB52158.1| hypothetical protein B456_008G248500 [Gossypium raimondii] gi|763785088|gb|KJB52159.1| hypothetical protein B456_008G248500 [Gossypium raimondii] gi|763785089|gb|KJB52160.1| hypothetical protein B456_008G248500 [Gossypium raimondii] Length = 240 Score = 57.8 bits (138), Expect = 3e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +2 Query: 275 VMISNCSGPCVSYLLRKRALYNDMSRYVCC 364 +++ CSGPCVSY+LRKRALYNDMSRY CC Sbjct: 26 LLLFYCSGPCVSYMLRKRALYNDMSRYTCC 55