BLASTX nr result
ID: Forsythia21_contig00031909
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00031909 (760 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERM98834.1| hypothetical protein AMTR_s00093p00169580 [Ambore... 88 5e-15 gb|ERM97418.1| hypothetical protein AMTR_s00251p00013890 [Ambore... 63 8e-08 gb|ABD42933.1| ribosomal protein S14, partial (mitochondrion) [G... 49 4e-07 gb|ABD42936.1| ribosomal protein S14, partial (mitochondrion) [F... 49 4e-07 gb|EPS74577.1| hypothetical protein M569_00171 [Genlisea aurea] 47 1e-06 gb|AGL75404.1| ribosomal protein S14 (mitochondrion) [Utriculari... 47 1e-06 ref|YP_006460159.1| ribosomal protein subunit S14 (mitochondrion... 47 1e-06 ref|NP_064043.1| orf112a gene product (mitochondrion) [Beta vulg... 60 2e-06 ref|XP_008790687.1| PREDICTED: LOW QUALITY PROTEIN: ribosomal pr... 45 3e-06 ref|YP_005090361.1| ribosomal protein S14 (mitochondrion) [Phoen... 45 3e-06 gb|AHA47122.1| ribosomal protein S14 (mitochondrion) [Amborella ... 48 4e-06 gb|AFK40487.1| unknown [Lotus japonicus] 48 4e-06 sp|P14875.2|RT14_OENBE RecName: Full=Ribosomal protein S14, mito... 45 4e-06 ref|YP_002608213.1| ribosomal protein S14 [Carica papaya] gi|170... 45 4e-06 ref|YP_002608356.1| ribosomal protein S14 [Vitis vinifera] gi|20... 45 4e-06 ref|YP_007905721.1| ribosomal protein S14 (mitochondrion) [Lirio... 45 4e-06 ref|YP_007516857.1| ribosomal protein subunit S14 (mitochondrion... 45 4e-06 emb|CAA10612.1| ribosomal protein S14 [Pisum sativum] gi|4428031... 45 4e-06 ref|YP_004222815.1| ribosomal protein S14 [Vigna radiata] gi|501... 45 4e-06 gb|ERN18203.1| hypothetical protein AMTR_s00054p00223760, partia... 59 4e-06 >gb|ERM98834.1| hypothetical protein AMTR_s00093p00169580 [Amborella trichopoda] Length = 131 Score = 88.2 bits (217), Expect = 5e-15 Identities = 60/106 (56%), Positives = 64/106 (60%), Gaps = 8/106 (7%) Frame = -3 Query: 371 VTFVT*CYVHAVIFYLSKSTTLYVVYVWGAYLTGDREVPHFDSRPVSISDPRSRD----- 207 VT VT CYVHAVI L KS T YVV VWG REVP F+S PVSISDPRSR Sbjct: 26 VTLVTFCYVHAVILSLPKSITPYVVAVWGDRC--GREVPQFNSHPVSISDPRSRITRLGL 83 Query: 206 YSVRSE--AGR*WTYLPCL*TS-SGANSFGCYQDDFFMPIKGP*DA 78 + VRS+ AG TYL + G YQDDFFMPIKGP DA Sbjct: 84 FFVRSQQVAGNGPTYLVSSRSHICSIGLVGGYQDDFFMPIKGPRDA 129 >gb|ERM97418.1| hypothetical protein AMTR_s00251p00013890 [Amborella trichopoda] Length = 111 Score = 62.8 bits (151), Expect(2) = 8e-08 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +3 Query: 378 GIDHSSKYSKAENCCSLERRSAEVVPIIEVRVWD*AFRMRK 500 GIDH S++SKAENCCSLER S E +P EVRVWD AF+M K Sbjct: 55 GIDHYSQFSKAENCCSLERLSVEGIPTTEVRVWDWAFQMIK 95 Score = 21.6 bits (44), Expect(2) = 8e-08 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +2 Query: 497 KEKKCLVSLEKPTQISY 547 K +K VSL +P QISY Sbjct: 95 KTQKFFVSLIEPMQISY 111 >gb|ABD42933.1| ribosomal protein S14, partial (mitochondrion) [Guzmania lingulata] Length = 92 Score = 48.5 bits (114), Expect(2) = 4e-07 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = +2 Query: 2 NRCIFTGRPRSICKFFRISRIVLRG 76 NRCIFTGRPRS+ +FFRISRIV RG Sbjct: 53 NRCIFTGRPRSVVEFFRISRIVFRG 77 Score = 33.5 bits (75), Expect(2) = 4e-07 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +1 Query: 67 FTWIASQGPLMGIKKSSW 120 F +AS+GPLMGIKKSSW Sbjct: 75 FRGLASRGPLMGIKKSSW 92 >gb|ABD42936.1| ribosomal protein S14, partial (mitochondrion) [Flagellaria indica] Length = 93 Score = 48.5 bits (114), Expect(2) = 4e-07 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = +2 Query: 2 NRCIFTGRPRSICKFFRISRIVLRG 76 NRCIFTGRPRS+ +FFRISRIV RG Sbjct: 54 NRCIFTGRPRSVVEFFRISRIVFRG 78 Score = 33.5 bits (75), Expect(2) = 4e-07 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +1 Query: 67 FTWIASQGPLMGIKKSSW 120 F +AS+GPLMGIKKSSW Sbjct: 76 FRGLASRGPLMGIKKSSW 93 >gb|EPS74577.1| hypothetical protein M569_00171 [Genlisea aurea] Length = 100 Score = 46.6 bits (109), Expect(2) = 1e-06 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = +2 Query: 2 NRCIFTGRPRSICKFFRISRIVLRG 76 NRCI TGRPRS+ KFFRISRIV RG Sbjct: 61 NRCISTGRPRSVYKFFRISRIVFRG 85 Score = 33.5 bits (75), Expect(2) = 1e-06 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +1 Query: 67 FTWIASQGPLMGIKKSSW 120 F +AS+GPLMGIKKSSW Sbjct: 83 FRGLASRGPLMGIKKSSW 100 >gb|AGL75404.1| ribosomal protein S14 (mitochondrion) [Utricularia gibba] Length = 100 Score = 46.6 bits (109), Expect(2) = 1e-06 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = +2 Query: 2 NRCIFTGRPRSICKFFRISRIVLRG 76 NRCI TGRPRS+ KFFRISRIV RG Sbjct: 61 NRCISTGRPRSVYKFFRISRIVFRG 85 Score = 33.5 bits (75), Expect(2) = 1e-06 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +1 Query: 67 FTWIASQGPLMGIKKSSW 120 F +AS+GPLMGIKKSSW Sbjct: 83 FRGLASRGPLMGIKKSSW 100 >ref|YP_006460159.1| ribosomal protein subunit S14 (mitochondrion) (mitochondrion) [Erythranthe guttata] gi|340007669|gb|AEK26533.1| ribosomal protein subunit S14 (mitochondrion) (mitochondrion) [Erythranthe guttata] Length = 100 Score = 46.6 bits (109), Expect(2) = 1e-06 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = +2 Query: 2 NRCIFTGRPRSICKFFRISRIVLRG 76 NRCI TGRPRS+ KFFRISRIV RG Sbjct: 61 NRCISTGRPRSVYKFFRISRIVFRG 85 Score = 33.5 bits (75), Expect(2) = 1e-06 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +1 Query: 67 FTWIASQGPLMGIKKSSW 120 F +AS+GPLMGIKKSSW Sbjct: 83 FRGLASRGPLMGIKKSSW 100 >ref|NP_064043.1| orf112a gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|9049343|dbj|BAA99353.1| orf112a (mitochondrion) [Beta vulgaris subsp. vulgaris] Length = 112 Score = 59.7 bits (143), Expect = 2e-06 Identities = 34/64 (53%), Positives = 41/64 (64%), Gaps = 7/64 (10%) Frame = +3 Query: 174 PLPAGF---GPNGVIP*SR----IGDANRAGIEVGDLSIACQVCSPDIDYVQGSTLGKIE 332 P+PAG NG+IP G ++ G + +SI+CQVC PDIDYVQGSTLGKIE Sbjct: 49 PIPAGSLTEKTNGLIPYLESEMLTGRESKWGTSLPPVSISCQVCFPDIDYVQGSTLGKIE 108 Query: 333 YHRV 344 HRV Sbjct: 109 SHRV 112 >ref|XP_008790687.1| PREDICTED: LOW QUALITY PROTEIN: ribosomal protein S14, mitochondrial [Phoenix dactylifera] Length = 120 Score = 45.4 bits (106), Expect(2) = 3e-06 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = +2 Query: 2 NRCIFTGRPRSICKFFRISRIVLRG 76 NRCI TGRPRS+ +FFRISRIV RG Sbjct: 81 NRCISTGRPRSVVEFFRISRIVFRG 105 Score = 33.5 bits (75), Expect(2) = 3e-06 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +1 Query: 67 FTWIASQGPLMGIKKSSW 120 F +AS+GPLMGIKKSSW Sbjct: 103 FRGLASRGPLMGIKKSSW 120 >ref|YP_005090361.1| ribosomal protein S14 (mitochondrion) [Phoenix dactylifera] gi|343478413|gb|AEM43901.1| ribosomal protein S14 (mitochondrion) [Phoenix dactylifera] Length = 107 Score = 45.4 bits (106), Expect(2) = 3e-06 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = +2 Query: 2 NRCIFTGRPRSICKFFRISRIVLRG 76 NRCI TGRPRS+ +FFRISRIV RG Sbjct: 68 NRCISTGRPRSVVEFFRISRIVFRG 92 Score = 33.5 bits (75), Expect(2) = 3e-06 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +1 Query: 67 FTWIASQGPLMGIKKSSW 120 F +AS+GPLMGIKKSSW Sbjct: 90 FRGLASRGPLMGIKKSSW 107 >gb|AHA47122.1| ribosomal protein S14 (mitochondrion) [Amborella trichopoda] gi|567767323|gb|AHC94309.1| ribosomal protein S14 (mitochondrion) [Amborella trichopoda] Length = 100 Score = 48.1 bits (113), Expect(2) = 4e-06 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = +2 Query: 2 NRCIFTGRPRSICKFFRISRIVLRG 76 NRCIFTGRPRS+ +FFRISRIV RG Sbjct: 61 NRCIFTGRPRSVYEFFRISRIVFRG 85 Score = 30.4 bits (67), Expect(2) = 4e-06 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = +1 Query: 67 FTWIASQGPLMGIKKSSW 120 F +AS+G LMGIKKSSW Sbjct: 83 FRGLASRGSLMGIKKSSW 100 >gb|AFK40487.1| unknown [Lotus japonicus] Length = 62 Score = 48.1 bits (113), Expect(2) = 4e-06 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = +2 Query: 2 NRCIFTGRPRSICKFFRISRIVLRG 76 NRCIFTGRPRS+ +FFRISRIV RG Sbjct: 23 NRCIFTGRPRSVYEFFRISRIVFRG 47 Score = 30.4 bits (67), Expect(2) = 4e-06 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = +1 Query: 67 FTWIASQGPLMGIKKSSW 120 F +AS+G LMGIKKSSW Sbjct: 45 FRGLASRGSLMGIKKSSW 62 >sp|P14875.2|RT14_OENBE RecName: Full=Ribosomal protein S14, mitochondrial (mitochondrion) [Oenothera berteroana] gi|13194|emb|CAA34891.1| unnamed protein product (mitochondrion) [Oenothera berteroana] Length = 99 Score = 45.1 bits (105), Expect(2) = 4e-06 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = +2 Query: 2 NRCIFTGRPRSICKFFRISRIVLRG 76 NRCI TGRPRS+ +FFRISRIV RG Sbjct: 60 NRCISTGRPRSVYEFFRISRIVFRG 84 Score = 33.5 bits (75), Expect(2) = 4e-06 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +1 Query: 67 FTWIASQGPLMGIKKSSW 120 F +AS+GPLMGIKKSSW Sbjct: 82 FRGLASRGPLMGIKKSSW 99 >ref|YP_002608213.1| ribosomal protein S14 [Carica papaya] gi|170522392|gb|ACB20502.1| ribosomal protein S14 (mitochondrion) [Carica papaya] Length = 100 Score = 45.1 bits (105), Expect(2) = 4e-06 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = +2 Query: 2 NRCIFTGRPRSICKFFRISRIVLRG 76 NRCI TGRPRS+ +FFRISRIV RG Sbjct: 61 NRCISTGRPRSVYEFFRISRIVFRG 85 Score = 33.5 bits (75), Expect(2) = 4e-06 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +1 Query: 67 FTWIASQGPLMGIKKSSW 120 F +AS+GPLMGIKKSSW Sbjct: 83 FRGLASRGPLMGIKKSSW 100 >ref|YP_002608356.1| ribosomal protein S14 [Vitis vinifera] gi|209954152|emb|CAQ77588.1| ribosomal protein S14 [Vitis vinifera] gi|239764776|gb|ACS15244.1| ribosomal protein S14 [Vitis vinifera] Length = 118 Score = 45.1 bits (105), Expect(2) = 4e-06 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = +2 Query: 2 NRCIFTGRPRSICKFFRISRIVLRG 76 NRCI TGRPRS+ +FFRISRIV RG Sbjct: 79 NRCISTGRPRSVYEFFRISRIVFRG 103 Score = 33.5 bits (75), Expect(2) = 4e-06 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +1 Query: 67 FTWIASQGPLMGIKKSSW 120 F +AS+GPLMGIKKSSW Sbjct: 101 FRGLASRGPLMGIKKSSW 118 >ref|YP_007905721.1| ribosomal protein S14 (mitochondrion) [Liriodendron tulipifera] gi|849123230|ref|YP_009153935.1| ribosomal protein S14 (mitochondrion) [Gossypium hirsutum] gi|849123273|ref|YP_009153969.1| ribosomal protein S14 (mitochondrion) [Gossypium harknessii] gi|397911889|gb|AFO69221.1| ribosomal protein S14 (mitochondrion) [Gossypium hirsutum] gi|430728014|gb|AGA54171.1| ribosomal protein S14 (mitochondrion) [Gossypium hirsutum] gi|430728051|gb|AGA54207.1| ribosomal protein S14 (mitochondrion) [Gossypium harknessii] gi|480541925|gb|AGJ90418.1| ribosomal protein S14 (mitochondrion) [Liriodendron tulipifera] Length = 100 Score = 45.1 bits (105), Expect(2) = 4e-06 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = +2 Query: 2 NRCIFTGRPRSICKFFRISRIVLRG 76 NRCI TGRPRS+ +FFRISRIV RG Sbjct: 61 NRCISTGRPRSVYEFFRISRIVFRG 85 Score = 33.5 bits (75), Expect(2) = 4e-06 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +1 Query: 67 FTWIASQGPLMGIKKSSW 120 F +AS+GPLMGIKKSSW Sbjct: 83 FRGLASRGPLMGIKKSSW 100 >ref|YP_007516857.1| ribosomal protein subunit S14 (mitochondrion) [Glycine max] gi|403311553|gb|AFR34301.1| ribosomal protein subunit S14 (mitochondrion) [Glycine max] Length = 100 Score = 45.1 bits (105), Expect(2) = 4e-06 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = +2 Query: 2 NRCIFTGRPRSICKFFRISRIVLRG 76 NRCI TGRPRS+ +FFRISRIV RG Sbjct: 61 NRCISTGRPRSVYEFFRISRIVFRG 85 Score = 33.5 bits (75), Expect(2) = 4e-06 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +1 Query: 67 FTWIASQGPLMGIKKSSW 120 F +AS+GPLMGIKKSSW Sbjct: 83 FRGLASRGPLMGIKKSSW 100 >emb|CAA10612.1| ribosomal protein S14 [Pisum sativum] gi|442803110|gb|AGC78845.1| ribosomal protein S14 (mitochondrion) [Vicia faba] Length = 100 Score = 45.1 bits (105), Expect(2) = 4e-06 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = +2 Query: 2 NRCIFTGRPRSICKFFRISRIVLRG 76 NRCI TGRPRS+ +FFRISRIV RG Sbjct: 61 NRCISTGRPRSVYEFFRISRIVFRG 85 Score = 33.5 bits (75), Expect(2) = 4e-06 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +1 Query: 67 FTWIASQGPLMGIKKSSW 120 F +AS+GPLMGIKKSSW Sbjct: 83 FRGLASRGPLMGIKKSSW 100 >ref|YP_004222815.1| ribosomal protein S14 [Vigna radiata] gi|501595013|ref|YP_007889800.1| ribosomal protein S14 (mitochondrion) [Vigna angularis] gi|308206762|gb|ADO19899.1| ribosomal protein S14 [Vigna radiata] gi|478620959|dbj|BAN15005.1| ribosomal protein S14 (mitochondrion) [Vigna angularis] Length = 100 Score = 45.1 bits (105), Expect(2) = 4e-06 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = +2 Query: 2 NRCIFTGRPRSICKFFRISRIVLRG 76 NRCI TGRPRS+ +FFRISRIV RG Sbjct: 61 NRCISTGRPRSVYEFFRISRIVFRG 85 Score = 33.5 bits (75), Expect(2) = 4e-06 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +1 Query: 67 FTWIASQGPLMGIKKSSW 120 F +AS+GPLMGIKKSSW Sbjct: 83 FRGLASRGPLMGIKKSSW 100 >gb|ERN18203.1| hypothetical protein AMTR_s00054p00223760, partial [Amborella trichopoda] Length = 67 Score = 58.5 bits (140), Expect = 4e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 381 IDHSSKYSKAENCCSLERRSAEVVPIIEVRVWD 479 IDH S++SKAENCCSLE RSA+VVP I+VRVWD Sbjct: 35 IDHYSQFSKAENCCSLECRSAKVVPTIDVRVWD 67