BLASTX nr result
ID: Forsythia21_contig00031867
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00031867 (652 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009049820.1| hypothetical protein (mitochondrion) [Capsic... 112 2e-22 gb|AGC78894.1| hypothetical protein (mitochondrion) [Vicia faba]... 92 3e-16 ref|XP_010087758.1| hypothetical protein L484_008955 [Morus nota... 81 5e-13 ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] 69 2e-09 ref|XP_002535311.1| conserved hypothetical protein [Ricinus comm... 63 2e-07 ref|XP_010313185.1| PREDICTED: uncharacterized protein LOC101264... 60 8e-07 ref|XP_002531802.1| conserved hypothetical protein [Ricinus comm... 60 1e-06 >ref|YP_009049820.1| hypothetical protein (mitochondrion) [Capsicum annuum] gi|667751809|gb|AIG89896.1| hypothetical protein (mitochondrion) [Capsicum annuum] gi|667752092|gb|AIG90178.1| hypothetical protein (mitochondrion) [Capsicum annuum] Length = 102 Score = 112 bits (280), Expect = 2e-22 Identities = 49/55 (89%), Positives = 51/55 (92%) Frame = +2 Query: 17 GASIHQRRLKVLSEPCWIVTHHTALKPNLWWIPGDKVKALDPLPHTLRCSSPSIK 181 GASIHQRRLKVLSEPCWIVTHHTALKPNLWWIPGDKVK PLPHTLRCSSP ++ Sbjct: 17 GASIHQRRLKVLSEPCWIVTHHTALKPNLWWIPGDKVKTQHPLPHTLRCSSPVLR 71 >gb|AGC78894.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803272|gb|AGC79007.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 602 Score = 91.7 bits (226), Expect = 3e-16 Identities = 45/50 (90%), Positives = 45/50 (90%) Frame = -1 Query: 151 MGQRIKRFDFVSRDPPQVGFESRVMGHYPARFGEHF*SALVNRSPPIKQE 2 MGQRIKRFDFVSRD PQVGFESRVMG YPARFGEHF SALVN SP IKQE Sbjct: 1 MGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGEHFLSALVNGSPSIKQE 50 >ref|XP_010087758.1| hypothetical protein L484_008955 [Morus notabilis] gi|587839116|gb|EXB29791.1| hypothetical protein L484_008955 [Morus notabilis] Length = 69 Score = 80.9 bits (198), Expect = 5e-13 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +2 Query: 17 GASIHQRRLKVLSEPCWIVTHHTALKPNLWWIPGDKV 127 GASIHQRRLKVLSEPCWIVTHHTALKPNLWWIP D + Sbjct: 17 GASIHQRRLKVLSEPCWIVTHHTALKPNLWWIPADVI 53 >ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] Length = 306 Score = 68.9 bits (167), Expect = 2e-09 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -1 Query: 151 MGQRIKRFDFVSRDPPQVGFESRVMGHYPARFGE 50 MGQRIKRFDFVSRD PQVGFESRVMG YPARFGE Sbjct: 1 MGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGE 34 >ref|XP_002535311.1| conserved hypothetical protein [Ricinus communis] gi|223523476|gb|EEF27072.1| conserved hypothetical protein [Ricinus communis] Length = 63 Score = 62.8 bits (151), Expect = 2e-07 Identities = 37/60 (61%), Positives = 41/60 (68%), Gaps = 7/60 (11%) Frame = +2 Query: 191 SRDRLSFKPLAFGSDKSSPFGRFAQ-------VVFPYLP*RSELFWFEMRKEHRPSAMNE 349 +RDRLSFKPL+FGSDKSSPFGRFAQ V FP + S L RKEHRPS +NE Sbjct: 9 ARDRLSFKPLSFGSDKSSPFGRFAQVRWSSRSVGFPNVKSCSGL-----RKEHRPSTLNE 63 >ref|XP_010313185.1| PREDICTED: uncharacterized protein LOC101264997, partial [Solanum lycopersicum] Length = 294 Score = 60.5 bits (145), Expect = 8e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 151 MGQRIKRFDFVSRDPPQVGFESRVMGHYPAR 59 MGQR+ RFDFVSRDPPQVGF+SRVMG YPAR Sbjct: 1 MGQRMLRFDFVSRDPPQVGFQSRVMGDYPAR 31 >ref|XP_002531802.1| conserved hypothetical protein [Ricinus communis] gi|223528568|gb|EEF30590.1| conserved hypothetical protein [Ricinus communis] Length = 72 Score = 59.7 bits (143), Expect = 1e-06 Identities = 34/59 (57%), Positives = 38/59 (64%), Gaps = 1/59 (1%) Frame = +2 Query: 8 LDRGASIHQRRLKVLSEPCWIVTHHTALKPNLW-WIPGDKVKALDPLPHTLRCSSPSIK 181 L RG SI Q RLKVL EPC I+T++T GD VKALDPLPHTL+ SS IK Sbjct: 14 LTRGPSIQQCRLKVLCEPCRIITYYTTHSSQTCDGSQGDNVKALDPLPHTLKGSSTPIK 72