BLASTX nr result
ID: Forsythia21_contig00031827
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00031827 (363 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KMT03782.1| hypothetical protein BVRB_8g189280 isoform B [Bet... 58 3e-06 >gb|KMT03782.1| hypothetical protein BVRB_8g189280 isoform B [Beta vulgaris subsp. vulgaris] Length = 1629 Score = 57.8 bits (138), Expect = 3e-06 Identities = 33/51 (64%), Positives = 36/51 (70%), Gaps = 8/51 (15%) Frame = -2 Query: 164 EASPEARKIRVLCFVE--------EARVVLAPISKGTYALHSLSTKRALER 36 E SPEA K R LCFV+ +ARVVLA ISKG YAL+ LSTKRALER Sbjct: 1236 EVSPEASKTRSLCFVDKARSVLDLQARVVLASISKGAYALYLLSTKRALER 1286