BLASTX nr result
ID: Forsythia21_contig00031609
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00031609 (282 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EUN28341.1| hypothetical protein COCVIDRAFT_36565 [Bipolaris ... 69 1e-09 ref|XP_007684960.1| hypothetical protein COCMIDRAFT_86972 [Bipol... 69 1e-09 ref|XP_007717579.1| hypothetical protein COCCADRAFT_41315 [Bipol... 69 1e-09 ref|XP_008021398.1| hypothetical protein SETTUDRAFT_124776 [Seto... 69 1e-09 gb|EMD88812.1| hypothetical protein COCHEDRAFT_1196728 [Bipolari... 69 1e-09 ref|XP_007700128.1| hypothetical protein COCSADRAFT_181417 [Bipo... 69 1e-09 ref|XP_003302411.1| hypothetical protein PTT_14215 [Pyrenophora ... 69 1e-09 ref|XP_001936029.1| 60S ribosomal protein L14 [Pyrenophora triti... 69 1e-09 ref|XP_001798125.1| hypothetical protein SNOG_07798 [Phaeosphaer... 68 3e-09 ref|XP_003836391.1| hypothetical protein LEMA_P039270.1 [Leptosp... 63 9e-08 ref|XP_007781766.1| hypothetical protein W97_05547 [Coniosporium... 59 1e-06 gb|EKG18097.1| Ribosomal protein L14 [Macrophomina phaseolina MS6] 57 6e-06 >gb|EUN28341.1| hypothetical protein COCVIDRAFT_36565 [Bipolaris victoriae FI3] Length = 545 Score = 68.9 bits (167), Expect = 1e-09 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 280 GLNDFERFKVMKMRKQARFEVQKTFAKIRASAKA 179 GLNDFERFKVMKMRKQARFEVQKTFAKIRASAKA Sbjct: 512 GLNDFERFKVMKMRKQARFEVQKTFAKIRASAKA 545 >ref|XP_007684960.1| hypothetical protein COCMIDRAFT_86972 [Bipolaris oryzae ATCC 44560] gi|576935006|gb|EUC48514.1| hypothetical protein COCMIDRAFT_86972 [Bipolaris oryzae ATCC 44560] Length = 553 Score = 68.9 bits (167), Expect = 1e-09 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 280 GLNDFERFKVMKMRKQARFEVQKTFAKIRASAKA 179 GLNDFERFKVMKMRKQARFEVQKTFAKIRASAKA Sbjct: 520 GLNDFERFKVMKMRKQARFEVQKTFAKIRASAKA 553 >ref|XP_007717579.1| hypothetical protein COCCADRAFT_41315 [Bipolaris zeicola 26-R-13] gi|576913714|gb|EUC28123.1| hypothetical protein COCCADRAFT_41315 [Bipolaris zeicola 26-R-13] Length = 545 Score = 68.9 bits (167), Expect = 1e-09 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 280 GLNDFERFKVMKMRKQARFEVQKTFAKIRASAKA 179 GLNDFERFKVMKMRKQARFEVQKTFAKIRASAKA Sbjct: 512 GLNDFERFKVMKMRKQARFEVQKTFAKIRASAKA 545 >ref|XP_008021398.1| hypothetical protein SETTUDRAFT_124776 [Setosphaeria turcica Et28A] gi|482813917|gb|EOA90595.1| hypothetical protein SETTUDRAFT_124776 [Setosphaeria turcica Et28A] Length = 516 Score = 68.9 bits (167), Expect = 1e-09 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 280 GLNDFERFKVMKMRKQARFEVQKTFAKIRASAKA 179 GLNDFERFKVMKMRKQARFEVQKTFAKIRASAKA Sbjct: 483 GLNDFERFKVMKMRKQARFEVQKTFAKIRASAKA 516 >gb|EMD88812.1| hypothetical protein COCHEDRAFT_1196728 [Bipolaris maydis C5] gi|477588393|gb|ENI05472.1| hypothetical protein COCC4DRAFT_168293 [Bipolaris maydis ATCC 48331] Length = 552 Score = 68.9 bits (167), Expect = 1e-09 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 280 GLNDFERFKVMKMRKQARFEVQKTFAKIRASAKA 179 GLNDFERFKVMKMRKQARFEVQKTFAKIRASAKA Sbjct: 519 GLNDFERFKVMKMRKQARFEVQKTFAKIRASAKA 552 >ref|XP_007700128.1| hypothetical protein COCSADRAFT_181417 [Bipolaris sorokiniana ND90Pr] gi|451850996|gb|EMD64297.1| hypothetical protein COCSADRAFT_181417 [Bipolaris sorokiniana ND90Pr] Length = 554 Score = 68.9 bits (167), Expect = 1e-09 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 280 GLNDFERFKVMKMRKQARFEVQKTFAKIRASAKA 179 GLNDFERFKVMKMRKQARFEVQKTFAKIRASAKA Sbjct: 521 GLNDFERFKVMKMRKQARFEVQKTFAKIRASAKA 554 >ref|XP_003302411.1| hypothetical protein PTT_14215 [Pyrenophora teres f. teres 0-1] gi|311322230|gb|EFQ89471.1| hypothetical protein PTT_14215 [Pyrenophora teres f. teres 0-1] Length = 536 Score = 68.9 bits (167), Expect = 1e-09 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 280 GLNDFERFKVMKMRKQARFEVQKTFAKIRASAKA 179 GLNDFERFKVMKMRKQARFEVQKTFAKIRASAKA Sbjct: 503 GLNDFERFKVMKMRKQARFEVQKTFAKIRASAKA 536 >ref|XP_001936029.1| 60S ribosomal protein L14 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187983128|gb|EDU48616.1| 60S ribosomal protein L14 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 146 Score = 68.9 bits (167), Expect = 1e-09 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 280 GLNDFERFKVMKMRKQARFEVQKTFAKIRASAKA 179 GLNDFERFKVMKMRKQARFEVQKTFAKIRASAKA Sbjct: 113 GLNDFERFKVMKMRKQARFEVQKTFAKIRASAKA 146 >ref|XP_001798125.1| hypothetical protein SNOG_07798 [Phaeosphaeria nodorum SN15] gi|111064144|gb|EAT85264.1| hypothetical protein SNOG_07798 [Phaeosphaeria nodorum SN15] Length = 146 Score = 67.8 bits (164), Expect = 3e-09 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 280 GLNDFERFKVMKMRKQARFEVQKTFAKIRASAKA 179 GLNDFERFKVMKMRKQAR+EVQKTFAKIRASAKA Sbjct: 113 GLNDFERFKVMKMRKQARYEVQKTFAKIRASAKA 146 >ref|XP_003836391.1| hypothetical protein LEMA_P039270.1 [Leptosphaeria maculans JN3] gi|312212944|emb|CBX93026.1| hypothetical protein LEMA_P039270.1 [Leptosphaeria maculans JN3] Length = 171 Score = 62.8 bits (151), Expect = 9e-08 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 277 LNDFERFKVMKMRKQARFEVQKTFAKIRASAKA 179 LNDFERFKVMK+RKQAR EVQKTFAKIRASAKA Sbjct: 139 LNDFERFKVMKLRKQARHEVQKTFAKIRASAKA 171 >ref|XP_007781766.1| hypothetical protein W97_05547 [Coniosporium apollinis CBS 100218] gi|494829868|gb|EON66449.1| hypothetical protein W97_05547 [Coniosporium apollinis CBS 100218] Length = 148 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -3 Query: 277 LNDFERFKVMKMRKQARFEVQKTFAKIRASAKA 179 LNDFE+FKVM++RKQARFEVQK+ AK+RASAKA Sbjct: 116 LNDFEKFKVMRLRKQARFEVQKSLAKVRASAKA 148 >gb|EKG18097.1| Ribosomal protein L14 [Macrophomina phaseolina MS6] Length = 148 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 277 LNDFERFKVMKMRKQARFEVQKTFAKIRASAKA 179 L DFERFKVM++RKQA +EV+KTFAK+RASAKA Sbjct: 116 LTDFERFKVMRLRKQANYEVKKTFAKLRASAKA 148