BLASTX nr result
ID: Forsythia21_contig00031086
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00031086 (303 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009766183.1| PREDICTED: L-ascorbate oxidase homolog [Nico... 78 3e-12 ref|XP_009591795.1| PREDICTED: L-ascorbate oxidase homolog [Nico... 78 3e-12 gb|AAQ90182.1| ntp101 [Nicotiana tabacum] gi|37223177|gb|AAQ9018... 78 3e-12 ref|XP_009773470.1| PREDICTED: L-ascorbate oxidase homolog [Nico... 77 5e-12 dbj|BAO02510.1| predicted pollen-specific protein ortholog [Nico... 77 5e-12 ref|XP_006341879.1| PREDICTED: L-ascorbate oxidase homolog [Sola... 76 1e-11 ref|XP_004229062.1| PREDICTED: L-ascorbate oxidase homolog [Sola... 76 1e-11 ref|XP_009785667.1| PREDICTED: L-ascorbate oxidase homolog [Nico... 75 2e-11 ref|XP_006354116.1| PREDICTED: L-ascorbate oxidase homolog [Sola... 75 2e-11 ref|XP_009588330.1| PREDICTED: L-ascorbate oxidase homolog [Nico... 75 2e-11 gb|AAD02557.1| PGPS/NH15 [Petunia x hybrida] 75 2e-11 ref|XP_011653509.1| PREDICTED: L-ascorbate oxidase homolog [Cucu... 75 2e-11 sp|P29162.1|ASOL_TOBAC RecName: Full=L-ascorbate oxidase homolog... 75 2e-11 ref|XP_003635547.1| PREDICTED: L-ascorbate oxidase homolog [Viti... 75 2e-11 emb|CAN69061.1| hypothetical protein VITISV_032605 [Vitis vinifera] 75 2e-11 ref|XP_009624631.1| PREDICTED: L-ascorbate oxidase homolog [Nico... 74 3e-11 ref|XP_010034522.1| PREDICTED: L-ascorbate oxidase homolog [Euca... 74 3e-11 gb|AAQ90185.1| ntp805 [Nicotiana tabacum] 74 3e-11 ref|XP_006367595.1| PREDICTED: L-ascorbate oxidase homolog [Sola... 74 3e-11 ref|XP_004228635.1| PREDICTED: L-ascorbate oxidase homolog [Sola... 74 3e-11 >ref|XP_009766183.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris] Length = 558 Score = 77.8 bits (190), Expect = 3e-12 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +1 Query: 1 LGQQLYISVLSPERSLRDEYNIPDDDPLCGIVKGLPLPQPYLA 129 LGQQLY SVLSP RSLRDEYN+PD+ PLCGIVKG+P+P PY A Sbjct: 516 LGQQLYFSVLSPSRSLRDEYNLPDNHPLCGIVKGMPMPAPYTA 558 >ref|XP_009591795.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis] Length = 558 Score = 77.8 bits (190), Expect = 3e-12 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +1 Query: 1 LGQQLYISVLSPERSLRDEYNIPDDDPLCGIVKGLPLPQPYLA 129 LGQQLY SVLSP RSLRDEYN+PD+ PLCGIVKG+P+P PY A Sbjct: 516 LGQQLYFSVLSPSRSLRDEYNLPDNHPLCGIVKGMPMPAPYTA 558 >gb|AAQ90182.1| ntp101 [Nicotiana tabacum] gi|37223177|gb|AAQ90184.1| ntp302 [Nicotiana tabacum] Length = 558 Score = 77.8 bits (190), Expect = 3e-12 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +1 Query: 1 LGQQLYISVLSPERSLRDEYNIPDDDPLCGIVKGLPLPQPYLA 129 LGQQLY SVLSP RSLRDEYN+PD+ PLCGIVKG+P+P PY A Sbjct: 516 LGQQLYFSVLSPSRSLRDEYNLPDNHPLCGIVKGMPMPAPYTA 558 >ref|XP_009773470.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris] Length = 554 Score = 77.0 bits (188), Expect = 5e-12 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +1 Query: 1 LGQQLYISVLSPERSLRDEYNIPDDDPLCGIVKGLPLPQPYLA 129 LG+QLY SVLSP RSLRDEYNIPD+ PLCGIVKG+P+P PY A Sbjct: 512 LGEQLYFSVLSPSRSLRDEYNIPDNHPLCGIVKGMPMPAPYKA 554 >dbj|BAO02510.1| predicted pollen-specific protein ortholog [Nicotiana alata] Length = 555 Score = 77.0 bits (188), Expect = 5e-12 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +1 Query: 1 LGQQLYISVLSPERSLRDEYNIPDDDPLCGIVKGLPLPQPYLA 129 LG+QLY SVLSP RSLRDEYNIPD+ PLCGIVKG+P+P PY A Sbjct: 513 LGEQLYFSVLSPSRSLRDEYNIPDNHPLCGIVKGMPMPAPYKA 555 >ref|XP_006341879.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum] Length = 554 Score = 75.9 bits (185), Expect = 1e-11 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +1 Query: 1 LGQQLYISVLSPERSLRDEYNIPDDDPLCGIVKGLPLPQPYLA 129 LG+QLY SVLSP RSLRDEYN+PD+ PLCG+VKG+PLP PY A Sbjct: 512 LGEQLYFSVLSPGRSLRDEYNLPDNHPLCGVVKGMPLPTPYKA 554 >ref|XP_004229062.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum] Length = 554 Score = 75.9 bits (185), Expect = 1e-11 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = +1 Query: 1 LGQQLYISVLSPERSLRDEYNIPDDDPLCGIVKGLPLPQPYLA 129 LG+Q+Y SVLSP RSLRDEYN+PD+ PLCG+VKG+PLP PY A Sbjct: 512 LGEQMYFSVLSPSRSLRDEYNLPDNHPLCGVVKGMPLPAPYKA 554 >ref|XP_009785667.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris] gi|37223175|gb|AAQ90183.1| ntp201 [Nicotiana tabacum] Length = 559 Score = 75.1 bits (183), Expect = 2e-11 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +1 Query: 1 LGQQLYISVLSPERSLRDEYNIPDDDPLCGIVKGLPLPQPY 123 LGQQLY SVLSP RSLRDEYN+PD+ PLCGIVK +PLP PY Sbjct: 517 LGQQLYFSVLSPARSLRDEYNLPDNHPLCGIVKSMPLPSPY 557 >ref|XP_006354116.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum] Length = 557 Score = 75.1 bits (183), Expect = 2e-11 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = +1 Query: 1 LGQQLYISVLSPERSLRDEYNIPDDDPLCGIVKGLPLPQPYLA 129 LGQQLY SVLSP RSLRDEYN+PD+ PLCGIVK +P+P PY A Sbjct: 515 LGQQLYFSVLSPARSLRDEYNLPDNHPLCGIVKSMPMPSPYKA 557 >ref|XP_009588330.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis] Length = 589 Score = 74.7 bits (182), Expect = 2e-11 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = +1 Query: 1 LGQQLYISVLSPERSLRDEYNIPDDDPLCGIVKGLPLPQPYLA 129 LG+QLY SVLSP RSLRDEYNIPD+ PLCGIVKGL +P PY A Sbjct: 547 LGEQLYFSVLSPSRSLRDEYNIPDNHPLCGIVKGLSMPAPYKA 589 >gb|AAD02557.1| PGPS/NH15 [Petunia x hybrida] Length = 167 Score = 74.7 bits (182), Expect = 2e-11 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = +1 Query: 1 LGQQLYISVLSPERSLRDEYNIPDDDPLCGIVKGLPLPQPYLA 129 LGQQLY SVLSP SLRDEYN+PD+ PLCGIVKG+P+P PY A Sbjct: 125 LGQQLYFSVLSPSGSLRDEYNLPDNHPLCGIVKGMPMPAPYKA 167 >ref|XP_011653509.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus] Length = 553 Score = 74.7 bits (182), Expect = 2e-11 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = +1 Query: 1 LGQQLYISVLSPERSLRDEYNIPDDDPLCGIVKGLPLPQPY 123 LGQQLYISVLSP RSLRDEYNIPD LCG+VKG+PLP+PY Sbjct: 511 LGQQLYISVLSPARSLRDEYNIPDHTLLCGLVKGMPLPKPY 551 >sp|P29162.1|ASOL_TOBAC RecName: Full=L-ascorbate oxidase homolog; AltName: Full=Pollen-specific protein NTP303; Flags: Precursor [Nicotiana tabacum] gi|19902|emb|CAA43454.1| pollen specific protein [Nicotiana tabacum] Length = 554 Score = 74.7 bits (182), Expect = 2e-11 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = +1 Query: 1 LGQQLYISVLSPERSLRDEYNIPDDDPLCGIVKGLPLPQPYLA 129 LG+QLY SVLSP RSLRDEYNIPD+ PLCGIVKGL +P PY A Sbjct: 512 LGEQLYFSVLSPSRSLRDEYNIPDNHPLCGIVKGLSMPAPYKA 554 >ref|XP_003635547.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera] gi|359497650|ref|XP_003635599.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera] gi|296081435|emb|CBI18839.3| unnamed protein product [Vitis vinifera] gi|296090708|emb|CBI41110.3| unnamed protein product [Vitis vinifera] Length = 550 Score = 74.7 bits (182), Expect = 2e-11 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +1 Query: 1 LGQQLYISVLSPERSLRDEYNIPDDDPLCGIVKGLPLPQPY 123 LGQQLY+SVLSP RSLRDEYNIPD LCGIVKGLP PQPY Sbjct: 508 LGQQLYVSVLSPARSLRDEYNIPDVAELCGIVKGLPKPQPY 548 >emb|CAN69061.1| hypothetical protein VITISV_032605 [Vitis vinifera] Length = 562 Score = 74.7 bits (182), Expect = 2e-11 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +1 Query: 1 LGQQLYISVLSPERSLRDEYNIPDDDPLCGIVKGLPLPQPY 123 LGQQLY+SVLSP RSLRDEYNIPD LCGIVKGLP PQPY Sbjct: 520 LGQQLYVSVLSPARSLRDEYNIPDVAELCGIVKGLPKPQPY 560 >ref|XP_009624631.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis] Length = 559 Score = 74.3 bits (181), Expect = 3e-11 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +1 Query: 1 LGQQLYISVLSPERSLRDEYNIPDDDPLCGIVKGLPLPQPY 123 LGQQLY SVLSP RSLRDEYN+PD+ PLCGIVK +P+P PY Sbjct: 517 LGQQLYFSVLSPARSLRDEYNLPDNHPLCGIVKSMPMPSPY 557 >ref|XP_010034522.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis] gi|629085943|gb|KCW52300.1| hypothetical protein EUGRSUZ_J01720 [Eucalyptus grandis] Length = 552 Score = 74.3 bits (181), Expect = 3e-11 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +1 Query: 1 LGQQLYISVLSPERSLRDEYNIPDDDPLCGIVKGLPLPQPY 123 LGQ++YISVLSPERSLRDEYN+PD+ PLCG V GLPLP PY Sbjct: 510 LGQEMYISVLSPERSLRDEYNLPDNAPLCGSVVGLPLPAPY 550 >gb|AAQ90185.1| ntp805 [Nicotiana tabacum] Length = 559 Score = 74.3 bits (181), Expect = 3e-11 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +1 Query: 1 LGQQLYISVLSPERSLRDEYNIPDDDPLCGIVKGLPLPQPY 123 LGQQLY SVLSP RSLRDEYN+PD+ PLCGIVK +P+P PY Sbjct: 517 LGQQLYFSVLSPARSLRDEYNLPDNHPLCGIVKSMPMPSPY 557 >ref|XP_006367595.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum] Length = 567 Score = 74.3 bits (181), Expect = 3e-11 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +1 Query: 1 LGQQLYISVLSPERSLRDEYNIPDDDPLCGIVKGLPLPQPY 123 LGQQLY SVLSP RSLRDEYN+PD+ PLCGIVK +P+P PY Sbjct: 525 LGQQLYFSVLSPSRSLRDEYNLPDNHPLCGIVKSMPMPPPY 565 >ref|XP_004228635.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum] Length = 557 Score = 74.3 bits (181), Expect = 3e-11 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = +1 Query: 1 LGQQLYISVLSPERSLRDEYNIPDDDPLCGIVKGLPLPQPYLA 129 LGQQLY SVLSP RSLRDEYN+PD+ PLCGIVK +P+P PY A Sbjct: 515 LGQQLYFSVLSPARSLRDEYNLPDNHPLCGIVKTMPMPSPYKA 557