BLASTX nr result
ID: Forsythia21_contig00029438
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00029438 (362 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011077684.1| PREDICTED: mitochondrial import receptor sub... 100 3e-19 ref|XP_012850170.1| PREDICTED: mitochondrial import receptor sub... 100 6e-19 ref|XP_011077105.1| PREDICTED: mitochondrial import receptor sub... 99 8e-19 ref|XP_009768665.1| PREDICTED: mitochondrial import receptor sub... 99 8e-19 ref|XP_006360661.1| PREDICTED: mitochondrial import receptor sub... 99 1e-18 ref|XP_009628067.1| PREDICTED: mitochondrial import receptor sub... 98 2e-18 ref|XP_004242882.1| PREDICTED: mitochondrial import receptor sub... 98 2e-18 sp|O82067.3|TOM7A_SOLTU RecName: Full=Mitochondrial import recep... 98 2e-18 ref|XP_004240126.1| PREDICTED: mitochondrial import receptor sub... 97 3e-18 ref|XP_008391413.1| PREDICTED: mitochondrial import receptor sub... 96 7e-18 gb|EPS63209.1| hypothetical protein M569_11578 [Genlisea aurea] 95 2e-17 ref|NP_001043627.1| Os01g0626300 [Oryza sativa Japonica Group] g... 92 1e-16 ref|XP_009362070.1| PREDICTED: mitochondrial import receptor sub... 92 2e-16 ref|XP_007225789.1| hypothetical protein PRUPE_ppa014339mg [Prun... 92 2e-16 ref|XP_010915807.1| PREDICTED: mitochondrial import receptor sub... 91 2e-16 ref|XP_002458194.1| hypothetical protein SORBIDRAFT_03g028510 [S... 91 2e-16 ref|XP_009389359.1| PREDICTED: mitochondrial import receptor sub... 91 4e-16 ref|XP_009344055.1| PREDICTED: mitochondrial import receptor sub... 91 4e-16 ref|XP_008341149.1| PREDICTED: mitochondrial import receptor sub... 91 4e-16 ref|NP_001150221.1| mitochondrial import receptor subunit TOM7-1... 90 5e-16 >ref|XP_011077684.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Sesamum indicum] Length = 78 Score = 100 bits (250), Expect = 3e-19 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = -2 Query: 361 EEGSTAAAVAKFVKEWSTWTVKKAKVITHYGFIPLVIILGMNSEPKPSISQLLSPV 194 EEGS A A AKFVKEWSTWT+KKAKVITHYGFIP+VII+GMNSEPKPS+SQLLSPV Sbjct: 24 EEGSMAVA-AKFVKEWSTWTMKKAKVITHYGFIPMVIIIGMNSEPKPSLSQLLSPV 78 >ref|XP_012850170.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Erythranthe guttatus] gi|604313221|gb|EYU26552.1| hypothetical protein MIMGU_mgv1a017391mg [Erythranthe guttata] Length = 78 Score = 99.8 bits (247), Expect = 6e-19 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = -2 Query: 361 EEGSTAAAVAKFVKEWSTWTVKKAKVITHYGFIPLVIILGMNSEPKPSISQLLSPV 194 +EGS A A AKFVKEWSTWT+KKAKVITHYGFIPLVII+GMNS+PKPS+SQLLSPV Sbjct: 24 DEGSVAVA-AKFVKEWSTWTMKKAKVITHYGFIPLVIIIGMNSDPKPSLSQLLSPV 78 >ref|XP_011077105.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Sesamum indicum] Length = 78 Score = 99.4 bits (246), Expect = 8e-19 Identities = 48/56 (85%), Positives = 52/56 (92%) Frame = -2 Query: 361 EEGSTAAAVAKFVKEWSTWTVKKAKVITHYGFIPLVIILGMNSEPKPSISQLLSPV 194 EEGS A AKFVKEWSTWT+KKAKVITHYGFIP+VII+GMNSEPKPS+SQLLSPV Sbjct: 24 EEGSMVVA-AKFVKEWSTWTMKKAKVITHYGFIPMVIIIGMNSEPKPSLSQLLSPV 78 >ref|XP_009768665.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Nicotiana sylvestris] Length = 77 Score = 99.4 bits (246), Expect = 8e-19 Identities = 46/56 (82%), Positives = 50/56 (89%) Frame = -2 Query: 361 EEGSTAAAVAKFVKEWSTWTVKKAKVITHYGFIPLVIILGMNSEPKPSISQLLSPV 194 E+ AA++KFVKEW TWT KKAKVITHYGFIPLVIILGMNSEPKPS+SQLLSPV Sbjct: 22 EDDGAVAALSKFVKEWGTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLLSPV 77 >ref|XP_006360661.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Solanum tuberosum] Length = 78 Score = 98.6 bits (244), Expect = 1e-18 Identities = 46/56 (82%), Positives = 49/56 (87%) Frame = -2 Query: 361 EEGSTAAAVAKFVKEWSTWTVKKAKVITHYGFIPLVIILGMNSEPKPSISQLLSPV 194 E+G AV FVK+WSTWT KKAKVITHYGFIPLVIILGMNSEPKPS+SQLLSPV Sbjct: 23 EDGGAVTAVYTFVKDWSTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLLSPV 78 >ref|XP_009628067.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Nicotiana tomentosiformis] gi|698434433|ref|XP_009798962.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Nicotiana sylvestris] Length = 77 Score = 97.8 bits (242), Expect = 2e-18 Identities = 45/56 (80%), Positives = 48/56 (85%) Frame = -2 Query: 361 EEGSTAAAVAKFVKEWSTWTVKKAKVITHYGFIPLVIILGMNSEPKPSISQLLSPV 194 E+ A V KFVKEW TWT KKAKVITHYGFIPLVII+GMNSEPKPS+SQLLSPV Sbjct: 22 EDDGAVAVVGKFVKEWGTWTAKKAKVITHYGFIPLVIIIGMNSEPKPSLSQLLSPV 77 >ref|XP_004242882.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Solanum lycopersicum] Length = 77 Score = 97.8 bits (242), Expect = 2e-18 Identities = 45/56 (80%), Positives = 49/56 (87%) Frame = -2 Query: 361 EEGSTAAAVAKFVKEWSTWTVKKAKVITHYGFIPLVIILGMNSEPKPSISQLLSPV 194 E+ AAV KFVKEW TW+ KKAKVITHYGFIPLVII+GMNSEPKPS+SQLLSPV Sbjct: 22 EDDGAVAAVGKFVKEWGTWSAKKAKVITHYGFIPLVIIIGMNSEPKPSLSQLLSPV 77 >sp|O82067.3|TOM7A_SOLTU RecName: Full=Mitochondrial import receptor subunit TOM7-1; AltName: Full=Translocase of outer membrane 7 kDa subunit 1 gi|3319774|emb|CAA76125.1| TOM7 protein [Solanum tuberosum] Length = 72 Score = 97.8 bits (242), Expect = 2e-18 Identities = 45/56 (80%), Positives = 48/56 (85%) Frame = -2 Query: 361 EEGSTAAAVAKFVKEWSTWTVKKAKVITHYGFIPLVIILGMNSEPKPSISQLLSPV 194 E+ A V KFVKEW TWT KKAKVITHYGFIPLVII+GMNSEPKPS+SQLLSPV Sbjct: 17 EDDGAVAVVGKFVKEWGTWTAKKAKVITHYGFIPLVIIIGMNSEPKPSLSQLLSPV 72 >ref|XP_004240126.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Solanum lycopersicum] Length = 78 Score = 97.4 bits (241), Expect = 3e-18 Identities = 45/56 (80%), Positives = 49/56 (87%) Frame = -2 Query: 361 EEGSTAAAVAKFVKEWSTWTVKKAKVITHYGFIPLVIILGMNSEPKPSISQLLSPV 194 E+G AV FVK+W+TWT KKAKVITHYGFIPLVIILGMNSEPKPS+SQLLSPV Sbjct: 23 EDGGAVTAVYTFVKDWTTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLLSPV 78 >ref|XP_008391413.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Malus domestica] Length = 73 Score = 96.3 bits (238), Expect = 7e-18 Identities = 43/55 (78%), Positives = 51/55 (92%) Frame = -2 Query: 358 EGSTAAAVAKFVKEWSTWTVKKAKVITHYGFIPLVIILGMNSEPKPSISQLLSPV 194 +GS +VA+FVKEWSTWT+KKAKV+THYGFIPLVII+GMNS+PKP +SQLLSPV Sbjct: 19 KGSEERSVAQFVKEWSTWTMKKAKVVTHYGFIPLVIIIGMNSDPKPQLSQLLSPV 73 >gb|EPS63209.1| hypothetical protein M569_11578 [Genlisea aurea] Length = 81 Score = 94.7 bits (234), Expect = 2e-17 Identities = 44/56 (78%), Positives = 49/56 (87%) Frame = -2 Query: 361 EEGSTAAAVAKFVKEWSTWTVKKAKVITHYGFIPLVIILGMNSEPKPSISQLLSPV 194 EE +AAA K VK+WS W +KKAKVITHYGFIPL+II+GMNSEPKPSISQLLSPV Sbjct: 26 EEEGSAAAATKLVKQWSNWGLKKAKVITHYGFIPLIIIIGMNSEPKPSISQLLSPV 81 >ref|NP_001043627.1| Os01g0626300 [Oryza sativa Japonica Group] gi|11761083|dbj|BAB19073.1| TOM7-like protein [Oryza sativa Japonica Group] gi|54290251|dbj|BAD61183.1| TOM7-like protein [Oryza sativa Japonica Group] gi|113533158|dbj|BAF05541.1| Os01g0626300 [Oryza sativa Japonica Group] gi|125526917|gb|EAY75031.1| hypothetical protein OsI_02929 [Oryza sativa Indica Group] gi|125571240|gb|EAZ12755.1| hypothetical protein OsJ_02673 [Oryza sativa Japonica Group] Length = 80 Score = 92.0 bits (227), Expect = 1e-16 Identities = 40/56 (71%), Positives = 49/56 (87%) Frame = -2 Query: 361 EEGSTAAAVAKFVKEWSTWTVKKAKVITHYGFIPLVIILGMNSEPKPSISQLLSPV 194 EE STAAA +FVKEW+TWT+KK KV HYGFIPL+I++GM SEP+PS++QLLSPV Sbjct: 25 EEQSTAAAAVRFVKEWTTWTMKKTKVAAHYGFIPLIIVVGMRSEPRPSLAQLLSPV 80 >ref|XP_009362070.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Pyrus x bretschneideri] Length = 73 Score = 91.7 bits (226), Expect = 2e-16 Identities = 41/55 (74%), Positives = 49/55 (89%) Frame = -2 Query: 358 EGSTAAAVAKFVKEWSTWTVKKAKVITHYGFIPLVIILGMNSEPKPSISQLLSPV 194 +GS +VA+ VKEWSTW +KKAKV+THYGFIPLVII+GMNS+PKP +SQLLSPV Sbjct: 19 KGSEEGSVAQSVKEWSTWAMKKAKVVTHYGFIPLVIIIGMNSDPKPQLSQLLSPV 73 >ref|XP_007225789.1| hypothetical protein PRUPE_ppa014339mg [Prunus persica] gi|645234757|ref|XP_008223958.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Prunus mume] gi|462422725|gb|EMJ26988.1| hypothetical protein PRUPE_ppa014339mg [Prunus persica] Length = 73 Score = 91.7 bits (226), Expect = 2e-16 Identities = 40/55 (72%), Positives = 49/55 (89%) Frame = -2 Query: 358 EGSTAAAVAKFVKEWSTWTVKKAKVITHYGFIPLVIILGMNSEPKPSISQLLSPV 194 +GS +VA+ VKEWSTW +KKAKV+THYGFIPL+I++GMNSEPKP +SQLLSPV Sbjct: 19 KGSDERSVAQSVKEWSTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPQLSQLLSPV 73 >ref|XP_010915807.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Elaeis guineensis] Length = 69 Score = 91.3 bits (225), Expect = 2e-16 Identities = 40/54 (74%), Positives = 47/54 (87%) Frame = -2 Query: 355 GSTAAAVAKFVKEWSTWTVKKAKVITHYGFIPLVIILGMNSEPKPSISQLLSPV 194 G+ A+FVKEWSTWT+KKAKVI HYGFIPL+I++GMNSEPKP +SQLLSPV Sbjct: 16 GAEDGPTARFVKEWSTWTMKKAKVIAHYGFIPLIIVIGMNSEPKPHLSQLLSPV 69 >ref|XP_002458194.1| hypothetical protein SORBIDRAFT_03g028510 [Sorghum bicolor] gi|241930169|gb|EES03314.1| hypothetical protein SORBIDRAFT_03g028510 [Sorghum bicolor] Length = 79 Score = 91.3 bits (225), Expect = 2e-16 Identities = 39/56 (69%), Positives = 48/56 (85%) Frame = -2 Query: 361 EEGSTAAAVAKFVKEWSTWTVKKAKVITHYGFIPLVIILGMNSEPKPSISQLLSPV 194 E+ + AA + VKEW+TWT+KKAKV+ HYGFIPLVI++GMNSEPKPS+ QLLSPV Sbjct: 24 EDATAAATTVRLVKEWTTWTMKKAKVVAHYGFIPLVIVIGMNSEPKPSVFQLLSPV 79 >ref|XP_009389359.1| PREDICTED: mitochondrial import receptor subunit TOM7-2-like [Musa acuminata subsp. malaccensis] Length = 73 Score = 90.5 bits (223), Expect = 4e-16 Identities = 43/56 (76%), Positives = 49/56 (87%) Frame = -2 Query: 361 EEGSTAAAVAKFVKEWSTWTVKKAKVITHYGFIPLVIILGMNSEPKPSISQLLSPV 194 EEGS+AA K VKEWSTW +KKAKVITHYGFIPL+I++GMNSEPKP + QLLSPV Sbjct: 21 EEGSSAA---KCVKEWSTWAMKKAKVITHYGFIPLIIVIGMNSEPKPQLYQLLSPV 73 >ref|XP_009344055.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Pyrus x bretschneideri] Length = 73 Score = 90.5 bits (223), Expect = 4e-16 Identities = 41/55 (74%), Positives = 48/55 (87%) Frame = -2 Query: 358 EGSTAAAVAKFVKEWSTWTVKKAKVITHYGFIPLVIILGMNSEPKPSISQLLSPV 194 +GS +VA+ KEWSTW +KKAKV+THYGFIPLVII+GMNSEPKP +SQLLSPV Sbjct: 19 KGSEERSVAQSFKEWSTWALKKAKVVTHYGFIPLVIIIGMNSEPKPQLSQLLSPV 73 >ref|XP_008341149.1| PREDICTED: mitochondrial import receptor subunit TOM7-2-like [Malus domestica] gi|694409870|ref|XP_009379554.1| PREDICTED: mitochondrial import receptor subunit TOM7-2-like [Pyrus x bretschneideri] Length = 73 Score = 90.5 bits (223), Expect = 4e-16 Identities = 41/55 (74%), Positives = 48/55 (87%) Frame = -2 Query: 358 EGSTAAAVAKFVKEWSTWTVKKAKVITHYGFIPLVIILGMNSEPKPSISQLLSPV 194 +GS +VA+ KEWSTW +KKAKV+THYGFIPLVII+GMNSEPKP +SQLLSPV Sbjct: 19 KGSEERSVAQSFKEWSTWALKKAKVVTHYGFIPLVIIIGMNSEPKPQLSQLLSPV 73 >ref|NP_001150221.1| mitochondrial import receptor subunit TOM7-1 [Zea mays] gi|195606532|gb|ACG25096.1| mitochondrial import receptor subunit TOM7-1 [Zea mays] gi|195637638|gb|ACG38287.1| mitochondrial import receptor subunit TOM7-1 [Zea mays] gi|195658849|gb|ACG48892.1| mitochondrial import receptor subunit TOM7-1 [Zea mays] gi|223945683|gb|ACN26925.1| unknown [Zea mays] gi|413950686|gb|AFW83335.1| import receptor subunit TOM7-1 [Zea mays] Length = 79 Score = 90.1 bits (222), Expect = 5e-16 Identities = 38/56 (67%), Positives = 48/56 (85%) Frame = -2 Query: 361 EEGSTAAAVAKFVKEWSTWTVKKAKVITHYGFIPLVIILGMNSEPKPSISQLLSPV 194 E+ + AA + +KEW+TWT+KKAKV+ HYGFIPLVI++GMNSEPKPS+ QLLSPV Sbjct: 24 EDATAAATTVRLMKEWTTWTMKKAKVVAHYGFIPLVIVIGMNSEPKPSVFQLLSPV 79