BLASTX nr result
ID: Forsythia21_contig00029275
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00029275 (214 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010097007.1| hypothetical protein L484_024931 [Morus nota... 60 6e-07 ref|XP_010086633.1| hypothetical protein L484_004344 [Morus nota... 57 6e-06 gb|ACY01928.1| hypothetical protein [Beta vulgaris] 56 8e-06 >ref|XP_010097007.1| hypothetical protein L484_024931 [Morus notabilis] gi|587877599|gb|EXB66634.1| hypothetical protein L484_024931 [Morus notabilis] Length = 195 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/53 (49%), Positives = 35/53 (66%) Frame = -1 Query: 193 RLKISMFYNGSPDWWLSRAERIFRVNRLLESEKVEVAAVCFDGEAWEWFQLVD 35 RL++ +F +P+ WL R ER F VNRL E +K+ AA+CF G+A WFQ D Sbjct: 103 RLEMPLFEGDNPEGWLFRVERYFSVNRLTEEDKLSAAAICFKGDALAWFQWED 155 >ref|XP_010086633.1| hypothetical protein L484_004344 [Morus notabilis] gi|587831464|gb|EXB22352.1| hypothetical protein L484_004344 [Morus notabilis] Length = 617 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/57 (49%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = -1 Query: 211 QLDSRGR-LKISMFYNGSPDWWLSRAERIFRVNRLLESEKVEVAAVCFDGEAWEWFQ 44 Q++ RGR L++ +F P WL RAER F +N + E+EKV A+VCF+G A WFQ Sbjct: 549 QVEHRGRRLELPLFTGEDPYGWLFRAERYFSINGVEENEKVLAASVCFEGRALGWFQ 605 >gb|ACY01928.1| hypothetical protein [Beta vulgaris] Length = 1583 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/60 (46%), Positives = 36/60 (60%) Frame = -1 Query: 193 RLKISMFYNGSPDWWLSRAERIFRVNRLLESEKVEVAAVCFDGEAWEWFQLVDRL*IPHR 14 +L + +F +PD W+ RAER F+ RL E EKVE A V DGEA W+Q +R HR Sbjct: 101 KLDLPVFSGNNPDGWIIRAERFFQFYRLTEDEKVEAAVVSLDGEALLWYQWENRRRPIHR 160