BLASTX nr result
ID: Forsythia21_contig00029185
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00029185 (203 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP02160.1| unnamed protein product [Coffea canephora] 79 9e-13 ref|XP_011098529.1| PREDICTED: chloroplastic group IIA intron sp... 79 2e-12 ref|XP_012849118.1| PREDICTED: chloroplastic group IIA intron sp... 78 2e-12 ref|XP_008341495.1| PREDICTED: LOW QUALITY PROTEIN: chloroplasti... 67 5e-09 gb|KDO72359.1| hypothetical protein CISIN_1g001441mg [Citrus sin... 67 5e-09 gb|KDO72358.1| hypothetical protein CISIN_1g001441mg [Citrus sin... 67 5e-09 gb|KDO72357.1| hypothetical protein CISIN_1g001441mg [Citrus sin... 67 5e-09 gb|KDO72356.1| hypothetical protein CISIN_1g001441mg [Citrus sin... 67 5e-09 gb|KDO72355.1| hypothetical protein CISIN_1g001441mg [Citrus sin... 67 5e-09 gb|KDO72354.1| hypothetical protein CISIN_1g001441mg [Citrus sin... 67 5e-09 gb|KDO72351.1| hypothetical protein CISIN_1g001441mg [Citrus sin... 67 5e-09 ref|XP_006482481.1| PREDICTED: chloroplastic group IIA intron sp... 67 5e-09 ref|XP_006482480.1| PREDICTED: chloroplastic group IIA intron sp... 67 5e-09 ref|XP_006482479.1| PREDICTED: chloroplastic group IIA intron sp... 67 5e-09 ref|XP_006482478.1| PREDICTED: chloroplastic group IIA intron sp... 67 5e-09 ref|XP_006482476.1| PREDICTED: chloroplastic group IIA intron sp... 67 5e-09 gb|KDO72360.1| hypothetical protein CISIN_1g001441mg [Citrus sin... 66 8e-09 ref|XP_006431007.1| hypothetical protein CICLE_v10013715mg [Citr... 66 8e-09 ref|XP_010100925.1| Chloroplastic group IIA intron splicing faci... 65 2e-08 ref|XP_011047274.1| PREDICTED: chloroplastic group IIA intron sp... 65 2e-08 >emb|CDP02160.1| unnamed protein product [Coffea canephora] Length = 1034 Score = 79.3 bits (194), Expect = 9e-13 Identities = 40/67 (59%), Positives = 56/67 (83%) Frame = -1 Query: 203 REAMKRSTEAQRRESLKLHVLKLTQNIDKLKLRLAEDKDSNDIHMAKDLEHGVVEEQEMN 24 REAMKRS EAQRRESLKLHVLKLTQNID+LKL+LA++K +N +A++L+ + EEQE + Sbjct: 733 REAMKRSLEAQRRESLKLHVLKLTQNIDRLKLQLAKEKGTNKTDLAEELKLKLDEEQEPD 792 Query: 23 EIYITED 3 + + +++ Sbjct: 793 KFHSSKN 799 >ref|XP_011098529.1| PREDICTED: chloroplastic group IIA intron splicing facilitator CRS1, chloroplastic [Sesamum indicum] Length = 1054 Score = 78.6 bits (192), Expect = 2e-12 Identities = 37/63 (58%), Positives = 51/63 (80%) Frame = -1 Query: 203 REAMKRSTEAQRRESLKLHVLKLTQNIDKLKLRLAEDKDSNDIHMAKDLEHGVVEEQEMN 24 REAM+RS EAQRRESLKLHVLKL++NID++KL++A++ D ND+ + KDLE G V+++ Sbjct: 693 REAMRRSLEAQRRESLKLHVLKLSRNIDEMKLQMAKEGDPNDMQLTKDLELGFVDQKNSK 752 Query: 23 EIY 15 Y Sbjct: 753 NHY 755 >ref|XP_012849118.1| PREDICTED: chloroplastic group IIA intron splicing facilitator CRS1, chloroplastic [Erythranthe guttatus] gi|604346236|gb|EYU44699.1| hypothetical protein MIMGU_mgv1a000630mg [Erythranthe guttata] Length = 1040 Score = 78.2 bits (191), Expect = 2e-12 Identities = 38/56 (67%), Positives = 49/56 (87%) Frame = -1 Query: 203 REAMKRSTEAQRRESLKLHVLKLTQNIDKLKLRLAEDKDSNDIHMAKDLEHGVVEE 36 REAMKRS EAQRRESLKLHVLKL++NID+LKL++A+D+++N H+ +DLE G V E Sbjct: 696 REAMKRSLEAQRRESLKLHVLKLSKNIDELKLKMAKDENTNRPHLTEDLELGFVRE 751 >ref|XP_008341495.1| PREDICTED: LOW QUALITY PROTEIN: chloroplastic group IIA intron splicing facilitator CRS1, chloroplastic [Malus domestica] Length = 1090 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = -1 Query: 203 REAMKRSTEAQRRESLKLHVLKLTQNIDKLKLRLAEDKDSNDIHMAKD 60 REAMKRS EAQRRESLKLHVLKL +NI +LKL+L EDK+S++ H + Sbjct: 688 REAMKRSIEAQRRESLKLHVLKLNENIAELKLQLDEDKESDNTHSVNE 735 >gb|KDO72359.1| hypothetical protein CISIN_1g001441mg [Citrus sinensis] Length = 965 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/57 (57%), Positives = 46/57 (80%) Frame = -1 Query: 203 REAMKRSTEAQRRESLKLHVLKLTQNIDKLKLRLAEDKDSNDIHMAKDLEHGVVEEQ 33 REAMKRS EAQRR+SLKLHVL+LT+NI+KLKL+L +DK++N + + +V+E+ Sbjct: 700 REAMKRSLEAQRRQSLKLHVLELTRNIEKLKLQLVKDKEANSLETIDESILPLVKEE 756 >gb|KDO72358.1| hypothetical protein CISIN_1g001441mg [Citrus sinensis] Length = 1013 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/57 (57%), Positives = 46/57 (80%) Frame = -1 Query: 203 REAMKRSTEAQRRESLKLHVLKLTQNIDKLKLRLAEDKDSNDIHMAKDLEHGVVEEQ 33 REAMKRS EAQRR+SLKLHVL+LT+NI+KLKL+L +DK++N + + +V+E+ Sbjct: 700 REAMKRSLEAQRRQSLKLHVLELTRNIEKLKLQLVKDKEANSLETIDESILPLVKEE 756 >gb|KDO72357.1| hypothetical protein CISIN_1g001441mg [Citrus sinensis] Length = 1031 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/57 (57%), Positives = 46/57 (80%) Frame = -1 Query: 203 REAMKRSTEAQRRESLKLHVLKLTQNIDKLKLRLAEDKDSNDIHMAKDLEHGVVEEQ 33 REAMKRS EAQRR+SLKLHVL+LT+NI+KLKL+L +DK++N + + +V+E+ Sbjct: 700 REAMKRSLEAQRRQSLKLHVLELTRNIEKLKLQLVKDKEANSLETIDESILPLVKEE 756 >gb|KDO72356.1| hypothetical protein CISIN_1g001441mg [Citrus sinensis] Length = 1045 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/57 (57%), Positives = 46/57 (80%) Frame = -1 Query: 203 REAMKRSTEAQRRESLKLHVLKLTQNIDKLKLRLAEDKDSNDIHMAKDLEHGVVEEQ 33 REAMKRS EAQRR+SLKLHVL+LT+NI+KLKL+L +DK++N + + +V+E+ Sbjct: 700 REAMKRSLEAQRRQSLKLHVLELTRNIEKLKLQLVKDKEANSLETIDESILPLVKEE 756 >gb|KDO72355.1| hypothetical protein CISIN_1g001441mg [Citrus sinensis] Length = 1050 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/57 (57%), Positives = 46/57 (80%) Frame = -1 Query: 203 REAMKRSTEAQRRESLKLHVLKLTQNIDKLKLRLAEDKDSNDIHMAKDLEHGVVEEQ 33 REAMKRS EAQRR+SLKLHVL+LT+NI+KLKL+L +DK++N + + +V+E+ Sbjct: 700 REAMKRSLEAQRRQSLKLHVLELTRNIEKLKLQLVKDKEANSLETIDESILPLVKEE 756 >gb|KDO72354.1| hypothetical protein CISIN_1g001441mg [Citrus sinensis] Length = 1062 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/57 (57%), Positives = 46/57 (80%) Frame = -1 Query: 203 REAMKRSTEAQRRESLKLHVLKLTQNIDKLKLRLAEDKDSNDIHMAKDLEHGVVEEQ 33 REAMKRS EAQRR+SLKLHVL+LT+NI+KLKL+L +DK++N + + +V+E+ Sbjct: 700 REAMKRSLEAQRRQSLKLHVLELTRNIEKLKLQLVKDKEANSLETIDESILPLVKEE 756 >gb|KDO72351.1| hypothetical protein CISIN_1g001441mg [Citrus sinensis] gi|641853534|gb|KDO72352.1| hypothetical protein CISIN_1g001441mg [Citrus sinensis] gi|641853535|gb|KDO72353.1| hypothetical protein CISIN_1g001441mg [Citrus sinensis] Length = 1076 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/57 (57%), Positives = 46/57 (80%) Frame = -1 Query: 203 REAMKRSTEAQRRESLKLHVLKLTQNIDKLKLRLAEDKDSNDIHMAKDLEHGVVEEQ 33 REAMKRS EAQRR+SLKLHVL+LT+NI+KLKL+L +DK++N + + +V+E+ Sbjct: 700 REAMKRSLEAQRRQSLKLHVLELTRNIEKLKLQLVKDKEANSLETIDESILPLVKEE 756 >ref|XP_006482481.1| PREDICTED: chloroplastic group IIA intron splicing facilitator CRS1, chloroplastic-like isoform X6 [Citrus sinensis] Length = 1031 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/57 (57%), Positives = 46/57 (80%) Frame = -1 Query: 203 REAMKRSTEAQRRESLKLHVLKLTQNIDKLKLRLAEDKDSNDIHMAKDLEHGVVEEQ 33 REAMKRS EAQRR+SLKLHVL+LT+NI+KLKL+L +DK++N + + +V+E+ Sbjct: 700 REAMKRSLEAQRRQSLKLHVLELTRNIEKLKLQLVKDKEANSLETIDESILPLVKEE 756 >ref|XP_006482480.1| PREDICTED: chloroplastic group IIA intron splicing facilitator CRS1, chloroplastic-like isoform X5 [Citrus sinensis] Length = 1045 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/57 (57%), Positives = 46/57 (80%) Frame = -1 Query: 203 REAMKRSTEAQRRESLKLHVLKLTQNIDKLKLRLAEDKDSNDIHMAKDLEHGVVEEQ 33 REAMKRS EAQRR+SLKLHVL+LT+NI+KLKL+L +DK++N + + +V+E+ Sbjct: 700 REAMKRSLEAQRRQSLKLHVLELTRNIEKLKLQLVKDKEANSLETIDESILPLVKEE 756 >ref|XP_006482479.1| PREDICTED: chloroplastic group IIA intron splicing facilitator CRS1, chloroplastic-like isoform X4 [Citrus sinensis] Length = 1050 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/57 (57%), Positives = 46/57 (80%) Frame = -1 Query: 203 REAMKRSTEAQRRESLKLHVLKLTQNIDKLKLRLAEDKDSNDIHMAKDLEHGVVEEQ 33 REAMKRS EAQRR+SLKLHVL+LT+NI+KLKL+L +DK++N + + +V+E+ Sbjct: 700 REAMKRSLEAQRRQSLKLHVLELTRNIEKLKLQLVKDKEANSLETIDESILPLVKEE 756 >ref|XP_006482478.1| PREDICTED: chloroplastic group IIA intron splicing facilitator CRS1, chloroplastic-like isoform X3 [Citrus sinensis] Length = 1062 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/57 (57%), Positives = 46/57 (80%) Frame = -1 Query: 203 REAMKRSTEAQRRESLKLHVLKLTQNIDKLKLRLAEDKDSNDIHMAKDLEHGVVEEQ 33 REAMKRS EAQRR+SLKLHVL+LT+NI+KLKL+L +DK++N + + +V+E+ Sbjct: 700 REAMKRSLEAQRRQSLKLHVLELTRNIEKLKLQLVKDKEANSLETIDESILPLVKEE 756 >ref|XP_006482476.1| PREDICTED: chloroplastic group IIA intron splicing facilitator CRS1, chloroplastic-like isoform X1 [Citrus sinensis] gi|568857850|ref|XP_006482477.1| PREDICTED: chloroplastic group IIA intron splicing facilitator CRS1, chloroplastic-like isoform X2 [Citrus sinensis] Length = 1076 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/57 (57%), Positives = 46/57 (80%) Frame = -1 Query: 203 REAMKRSTEAQRRESLKLHVLKLTQNIDKLKLRLAEDKDSNDIHMAKDLEHGVVEEQ 33 REAMKRS EAQRR+SLKLHVL+LT+NI+KLKL+L +DK++N + + +V+E+ Sbjct: 700 REAMKRSLEAQRRQSLKLHVLELTRNIEKLKLQLVKDKEANSLETIDESILPLVKEE 756 >gb|KDO72360.1| hypothetical protein CISIN_1g001441mg [Citrus sinensis] Length = 770 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/43 (72%), Positives = 40/43 (93%) Frame = -1 Query: 203 REAMKRSTEAQRRESLKLHVLKLTQNIDKLKLRLAEDKDSNDI 75 REAMKRS EAQRR+SLKLHVL+LT+NI+KLKL+L +DK++N + Sbjct: 700 REAMKRSLEAQRRQSLKLHVLELTRNIEKLKLQLVKDKEANSL 742 >ref|XP_006431007.1| hypothetical protein CICLE_v10013715mg [Citrus clementina] gi|557533064|gb|ESR44247.1| hypothetical protein CICLE_v10013715mg [Citrus clementina] Length = 1062 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/43 (72%), Positives = 40/43 (93%) Frame = -1 Query: 203 REAMKRSTEAQRRESLKLHVLKLTQNIDKLKLRLAEDKDSNDI 75 REAMKRS EAQRR+SLKLHVL+LT+NI+KLKL+L +DK++N + Sbjct: 700 REAMKRSLEAQRRQSLKLHVLELTRNIEKLKLQLVKDKEANSL 742 >ref|XP_010100925.1| Chloroplastic group IIA intron splicing facilitator CRS1 [Morus notabilis] gi|587959642|gb|EXC45069.1| Chloroplastic group IIA intron splicing facilitator CRS1 [Morus notabilis] Length = 966 Score = 64.7 bits (156), Expect = 2e-08 Identities = 34/56 (60%), Positives = 42/56 (75%) Frame = -1 Query: 203 REAMKRSTEAQRRESLKLHVLKLTQNIDKLKLRLAEDKDSNDIHMAKDLEHGVVEE 36 R AMKRS EAQRR+SLKLHVLKLT+NID LKL+L +DK N + A + + V +E Sbjct: 685 RAAMKRSIEAQRRQSLKLHVLKLTKNIDDLKLQLVKDKQRNKMQPADESSNLVRDE 740 >ref|XP_011047274.1| PREDICTED: chloroplastic group IIA intron splicing facilitator CRS1, chloroplastic [Populus euphratica] Length = 1026 Score = 64.7 bits (156), Expect = 2e-08 Identities = 33/58 (56%), Positives = 43/58 (74%) Frame = -1 Query: 203 REAMKRSTEAQRRESLKLHVLKLTQNIDKLKLRLAEDKDSNDIHMAKDLEHGVVEEQE 30 R+AMKRS EAQRRESLKLHVL+LT NID LKL+L +DK++ ++ + + V E E Sbjct: 685 RQAMKRSLEAQRRESLKLHVLRLTSNIDHLKLQLVKDKEAYNVQCFDESKFQVKGESE 742