BLASTX nr result
ID: Forsythia21_contig00028430
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00028430 (390 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012844372.1| PREDICTED: probable phytol kinase 3, chlorop... 66 1e-08 ref|XP_011098894.1| PREDICTED: probable phytol kinase 3, chlorop... 64 4e-08 ref|XP_006354090.1| PREDICTED: probable phytol kinase 3, chlorop... 62 1e-07 gb|ADZ24711.1| phytol kinase [Solanum pennellii] 62 2e-07 ref|XP_004246260.1| PREDICTED: probable phytol kinase 3, chlorop... 60 4e-07 ref|XP_009774666.1| PREDICTED: probable phytol kinase 3, chlorop... 57 5e-06 ref|XP_009790459.1| PREDICTED: probable phytol kinase 3, chlorop... 57 5e-06 >ref|XP_012844372.1| PREDICTED: probable phytol kinase 3, chloroplastic [Erythranthe guttatus] gi|604347108|gb|EYU45412.1| hypothetical protein MIMGU_mgv1a010789mg [Erythranthe guttata] Length = 301 Score = 65.9 bits (159), Expect = 1e-08 Identities = 40/92 (43%), Positives = 55/92 (59%), Gaps = 2/92 (2%) Frame = -2 Query: 272 MASTILSLSITVKSNSIF-NSGSNSAPPPYSSYFLNRFTFGQQLKGKPRRT-LRQKLTSS 99 M + +S+++ + SI NS SN P + F Q +K KPRR +R++L S Sbjct: 1 MVQSCISMALKLAFFSISPNSSSNFCCPTLRRTHCSEFV--QLIKSKPRRRRIRRELKSV 58 Query: 98 AVMFSENPVISDFIATALSGGIALSLLRLWEE 3 A MFS N + D +AT LSGGIALSLL++WEE Sbjct: 59 AAMFSNNTAVGDLVATGLSGGIALSLLKIWEE 90 >ref|XP_011098894.1| PREDICTED: probable phytol kinase 3, chloroplastic [Sesamum indicum] Length = 292 Score = 63.9 bits (154), Expect = 4e-08 Identities = 43/91 (47%), Positives = 54/91 (59%), Gaps = 1/91 (1%) Frame = -2 Query: 272 MASTILSLSITVKSNSIFNSGSNSAPPPYSSYFLNRFTFGQQLKGKPRRT-LRQKLTSSA 96 MASTI SI +S S F S+ + F F Q K KPRR +R++L +A Sbjct: 1 MASTIAYFSIPPRSTSNF----------CCSFKTHFFGFVQLPKVKPRRRRIRRELKRAA 50 Query: 95 VMFSENPVISDFIATALSGGIALSLLRLWEE 3 MFS V+SD IAT LSGGIALSLL++WE+ Sbjct: 51 AMFSGTTVVSDAIATGLSGGIALSLLKIWEQ 81 >ref|XP_006354090.1| PREDICTED: probable phytol kinase 3, chloroplastic-like [Solanum tuberosum] Length = 293 Score = 62.4 bits (150), Expect = 1e-07 Identities = 39/75 (52%), Positives = 46/75 (61%), Gaps = 1/75 (1%) Frame = -2 Query: 224 IFNSGSNSAPPPYSSYFLNR-FTFGQQLKGKPRRTLRQKLTSSAVMFSENPVISDFIATA 48 +F S S+ PY + + F G Q K K RR R K+ MFSENP+I D IATA Sbjct: 13 LFKSNSD----PYRLFSTKKGFNLGFQ-KLKTRRLHRTKVVVHFAMFSENPLIGDLIATA 67 Query: 47 LSGGIALSLLRLWEE 3 SGGIALS+LRLWEE Sbjct: 68 FSGGIALSMLRLWEE 82 >gb|ADZ24711.1| phytol kinase [Solanum pennellii] Length = 293 Score = 62.0 bits (149), Expect = 2e-07 Identities = 44/90 (48%), Positives = 53/90 (58%), Gaps = 1/90 (1%) Frame = -2 Query: 269 ASTILSLSITVKSNSIFNSGSNSAPPPYSSYFLNR-FTFGQQLKGKPRRTLRQKLTSSAV 93 AS++L LS+ +KSNS PY + + F G Q K K RR R K+ Sbjct: 5 ASSVLPLSL-LKSNS----------DPYRLFSTKKGFNLGFQ-KLKTRRLHRTKVVVHFA 52 Query: 92 MFSENPVISDFIATALSGGIALSLLRLWEE 3 MFSEN +I D IATALSGGIALS+LR WEE Sbjct: 53 MFSENLLIGDLIATALSGGIALSILRFWEE 82 >ref|XP_004246260.1| PREDICTED: probable phytol kinase 3, chloroplastic [Solanum lycopersicum] Length = 293 Score = 60.5 bits (145), Expect = 4e-07 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 1/90 (1%) Frame = -2 Query: 269 ASTILSLSITVKSNSIFNSGSNSAPPPYSSYFLNR-FTFGQQLKGKPRRTLRQKLTSSAV 93 AS++L LS+ +KSNS PY + + F G Q K K RR R K+ Sbjct: 5 ASSVLPLSL-LKSNS----------DPYRLFSTKKGFNLGFQ-KLKTRRLHRTKVVVHFA 52 Query: 92 MFSENPVISDFIATALSGGIALSLLRLWEE 3 MFSEN +I D IAT LSGGIALS+LR WEE Sbjct: 53 MFSENLLIGDLIATTLSGGIALSILRFWEE 82 >ref|XP_009774666.1| PREDICTED: probable phytol kinase 3, chloroplastic, partial [Nicotiana sylvestris] Length = 96 Score = 57.0 bits (136), Expect = 5e-06 Identities = 36/57 (63%), Positives = 40/57 (70%) Frame = -2 Query: 173 LNRFTFGQQLKGKPRRTLRQKLTSSAVMFSENPVISDFIATALSGGIALSLLRLWEE 3 LNRF G K K RR L ++ A MF ENPV+ D IATALSGGIALS+LRLWEE Sbjct: 34 LNRFNSGIH-KLKTRR-LHSEVRPKA-MFLENPVMGDLIATALSGGIALSMLRLWEE 87 >ref|XP_009790459.1| PREDICTED: probable phytol kinase 3, chloroplastic [Nicotiana sylvestris] Length = 298 Score = 57.0 bits (136), Expect = 5e-06 Identities = 36/57 (63%), Positives = 40/57 (70%) Frame = -2 Query: 173 LNRFTFGQQLKGKPRRTLRQKLTSSAVMFSENPVISDFIATALSGGIALSLLRLWEE 3 LNRF G K K RR L ++ A MF ENPV+ D IATALSGGIALS+LRLWEE Sbjct: 34 LNRFNSGIH-KLKTRR-LHSEVRPKA-MFLENPVMGDLIATALSGGIALSMLRLWEE 87