BLASTX nr result
ID: Forsythia21_contig00028055
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00028055 (605 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDP42426.1| hypothetical protein JCGZ_00223 [Jatropha curcas] 70 8e-10 ref|XP_011028333.1| PREDICTED: embryogenesis-associated protein ... 70 1e-09 ref|XP_006385025.1| embryogenesis-associated family protein [Pop... 70 1e-09 ref|XP_011092320.1| PREDICTED: embryogenesis-associated protein ... 69 2e-09 ref|XP_012066652.1| PREDICTED: embryogenesis-associated protein ... 67 7e-09 emb|CBI29717.3| unnamed protein product [Vitis vinifera] 67 7e-09 ref|XP_002263770.1| PREDICTED: abhydrolase domain-containing pro... 67 7e-09 ref|XP_012849869.1| PREDICTED: embryogenesis-associated protein ... 66 1e-08 ref|XP_002533883.1| alpha/beta hydrolase domain containing prote... 66 1e-08 ref|XP_002533881.1| alpha/beta hydrolase domain containing prote... 66 1e-08 gb|EYU26944.1| hypothetical protein MIMGU_mgv1a0038151mg, partia... 66 1e-08 ref|XP_007041253.1| Alpha/beta-Hydrolases superfamily protein is... 65 3e-08 ref|XP_007041252.1| Alpha/beta-Hydrolases superfamily protein, p... 65 3e-08 emb|CDO97600.1| unnamed protein product [Coffea canephora] 65 3e-08 ref|XP_009599882.1| PREDICTED: embryogenesis-associated protein ... 64 4e-08 ref|XP_006402204.1| hypothetical protein EUTSA_v10013194mg [Eutr... 63 1e-07 ref|XP_012436506.1| PREDICTED: embryogenesis-associated protein ... 63 1e-07 gb|KJB47847.1| hypothetical protein B456_008G045200 [Gossypium r... 63 1e-07 ref|XP_012436505.1| PREDICTED: embryogenesis-associated protein ... 63 1e-07 ref|XP_006349340.1| PREDICTED: embryogenesis-associated protein ... 63 1e-07 >gb|KDP42426.1| hypothetical protein JCGZ_00223 [Jatropha curcas] Length = 478 Score = 70.1 bits (170), Expect = 8e-10 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 104 DSCHQSDCFYNAGWTEDVRKVIDHLHCQYPEAPL 3 DS SDCFYNAGWTED+R +IDH+HCQYPEAPL Sbjct: 162 DSASASDCFYNAGWTEDIRSIIDHIHCQYPEAPL 195 Score = 67.0 bits (162), Expect = 7e-09 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 89 SDCFYNAGWTEDVRKVIDHLHCQYPEAPL 3 SDCFYNAGWTED+R +IDH+HCQYPEAPL Sbjct: 208 SDCFYNAGWTEDIRSIIDHIHCQYPEAPL 236 >ref|XP_011028333.1| PREDICTED: embryogenesis-associated protein EMB8 [Populus euphratica] Length = 580 Score = 69.7 bits (169), Expect = 1e-09 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -1 Query: 89 SDCFYNAGWTEDVRKVIDHLHCQYPEAPL 3 SDCFYNAGWTEDVRKVIDH+HCQYPEAPL Sbjct: 210 SDCFYNAGWTEDVRKVIDHIHCQYPEAPL 238 >ref|XP_006385025.1| embryogenesis-associated family protein [Populus trichocarpa] gi|550341793|gb|ERP62822.1| embryogenesis-associated family protein [Populus trichocarpa] Length = 546 Score = 69.7 bits (169), Expect = 1e-09 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -1 Query: 89 SDCFYNAGWTEDVRKVIDHLHCQYPEAPL 3 SDCFYNAGWTEDVRKVIDH+HCQYPEAPL Sbjct: 210 SDCFYNAGWTEDVRKVIDHIHCQYPEAPL 238 >ref|XP_011092320.1| PREDICTED: embryogenesis-associated protein EMB8-like isoform X1 [Sesamum indicum] Length = 572 Score = 68.9 bits (167), Expect = 2e-09 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -1 Query: 89 SDCFYNAGWTEDVRKVIDHLHCQYPEAPL 3 SDCFYNAGWTEDVRKVIDHLHCQ+PEAPL Sbjct: 203 SDCFYNAGWTEDVRKVIDHLHCQFPEAPL 231 >ref|XP_012066652.1| PREDICTED: embryogenesis-associated protein EMB8-like [Jatropha curcas] Length = 253 Score = 67.0 bits (162), Expect = 7e-09 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 89 SDCFYNAGWTEDVRKVIDHLHCQYPEAPL 3 SDCFYNAGWTED+R +IDH+HCQYPEAPL Sbjct: 197 SDCFYNAGWTEDIRSIIDHIHCQYPEAPL 225 >emb|CBI29717.3| unnamed protein product [Vitis vinifera] Length = 545 Score = 67.0 bits (162), Expect = 7e-09 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 89 SDCFYNAGWTEDVRKVIDHLHCQYPEAPL 3 SDC YNAGWTED+RK++DHLHCQYPEAPL Sbjct: 196 SDCMYNAGWTEDIRKIVDHLHCQYPEAPL 224 >ref|XP_002263770.1| PREDICTED: abhydrolase domain-containing protein 3 [Vitis vinifera] Length = 568 Score = 67.0 bits (162), Expect = 7e-09 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 89 SDCFYNAGWTEDVRKVIDHLHCQYPEAPL 3 SDC YNAGWTED+RK++DHLHCQYPEAPL Sbjct: 196 SDCMYNAGWTEDIRKIVDHLHCQYPEAPL 224 >ref|XP_012849869.1| PREDICTED: embryogenesis-associated protein EMB8-like [Erythranthe guttatus] Length = 449 Score = 66.2 bits (160), Expect = 1e-08 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 89 SDCFYNAGWTEDVRKVIDHLHCQYPEAPL 3 SDCFYN GWTEDVRKVIDHLHCQ+P+APL Sbjct: 90 SDCFYNGGWTEDVRKVIDHLHCQFPQAPL 118 >ref|XP_002533883.1| alpha/beta hydrolase domain containing protein 1,3, putative [Ricinus communis] gi|223526168|gb|EEF28501.1| alpha/beta hydrolase domain containing protein 1,3, putative [Ricinus communis] Length = 427 Score = 66.2 bits (160), Expect = 1e-08 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 89 SDCFYNAGWTEDVRKVIDHLHCQYPEAPL 3 SDCFYNAGWTED+R +IDH+HCQYPEAPL Sbjct: 127 SDCFYNAGWTEDLRSIIDHIHCQYPEAPL 155 >ref|XP_002533881.1| alpha/beta hydrolase domain containing protein 1,3, putative [Ricinus communis] gi|223526166|gb|EEF28499.1| alpha/beta hydrolase domain containing protein 1,3, putative [Ricinus communis] Length = 571 Score = 66.2 bits (160), Expect = 1e-08 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 89 SDCFYNAGWTEDVRKVIDHLHCQYPEAPL 3 SDCFYNAGWTED+R +IDH+HCQYPEAPL Sbjct: 201 SDCFYNAGWTEDLRSIIDHIHCQYPEAPL 229 >gb|EYU26944.1| hypothetical protein MIMGU_mgv1a0038151mg, partial [Erythranthe guttata] Length = 314 Score = 66.2 bits (160), Expect = 1e-08 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 89 SDCFYNAGWTEDVRKVIDHLHCQYPEAPL 3 SDCFYN GWTEDVRKVIDHLHCQ+P+APL Sbjct: 203 SDCFYNGGWTEDVRKVIDHLHCQFPQAPL 231 >ref|XP_007041253.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma cacao] gi|508705188|gb|EOX97084.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma cacao] Length = 414 Score = 65.1 bits (157), Expect = 3e-08 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 89 SDCFYNAGWTEDVRKVIDHLHCQYPEAPL 3 SDCFYNAGWTEDVRK+IDH+ C+YPEAPL Sbjct: 240 SDCFYNAGWTEDVRKIIDHIRCEYPEAPL 268 >ref|XP_007041252.1| Alpha/beta-Hydrolases superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705187|gb|EOX97083.1| Alpha/beta-Hydrolases superfamily protein, putative isoform 1 [Theobroma cacao] Length = 608 Score = 65.1 bits (157), Expect = 3e-08 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 89 SDCFYNAGWTEDVRKVIDHLHCQYPEAPL 3 SDCFYNAGWTEDVRK+IDH+ C+YPEAPL Sbjct: 240 SDCFYNAGWTEDVRKIIDHIRCEYPEAPL 268 >emb|CDO97600.1| unnamed protein product [Coffea canephora] Length = 457 Score = 64.7 bits (156), Expect = 3e-08 Identities = 24/29 (82%), Positives = 29/29 (100%) Frame = -1 Query: 89 SDCFYNAGWTEDVRKVIDHLHCQYPEAPL 3 SDCFYNAGWT+D+RKVI+H+HCQ+PEAPL Sbjct: 201 SDCFYNAGWTQDIRKVIEHIHCQHPEAPL 229 >ref|XP_009599882.1| PREDICTED: embryogenesis-associated protein EMB8-like [Nicotiana tomentosiformis] Length = 566 Score = 64.3 bits (155), Expect = 4e-08 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 89 SDCFYNAGWTEDVRKVIDHLHCQYPEAPL 3 SDCFYNAGWTED RKVIDHLH QYP+APL Sbjct: 199 SDCFYNAGWTEDARKVIDHLHAQYPQAPL 227 >ref|XP_006402204.1| hypothetical protein EUTSA_v10013194mg [Eutrema salsugineum] gi|557103294|gb|ESQ43657.1| hypothetical protein EUTSA_v10013194mg [Eutrema salsugineum] Length = 540 Score = 63.2 bits (152), Expect = 1e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 89 SDCFYNAGWTEDVRKVIDHLHCQYPEAPL 3 SDCFYNAGWTED+RKVIDH+H Q+PEAPL Sbjct: 195 SDCFYNAGWTEDLRKVIDHIHSQFPEAPL 223 >ref|XP_012436506.1| PREDICTED: embryogenesis-associated protein EMB8-like isoform X2 [Gossypium raimondii] gi|763780777|gb|KJB47848.1| hypothetical protein B456_008G045200 [Gossypium raimondii] Length = 462 Score = 62.8 bits (151), Expect = 1e-07 Identities = 24/29 (82%), Positives = 29/29 (100%) Frame = -1 Query: 89 SDCFYNAGWTEDVRKVIDHLHCQYPEAPL 3 SDCFYNAG+TED+RK+IDH+HC+YPEAPL Sbjct: 202 SDCFYNAGYTEDLRKLIDHIHCEYPEAPL 230 >gb|KJB47847.1| hypothetical protein B456_008G045200 [Gossypium raimondii] Length = 570 Score = 62.8 bits (151), Expect = 1e-07 Identities = 24/29 (82%), Positives = 29/29 (100%) Frame = -1 Query: 89 SDCFYNAGWTEDVRKVIDHLHCQYPEAPL 3 SDCFYNAG+TED+RK+IDH+HC+YPEAPL Sbjct: 202 SDCFYNAGYTEDLRKLIDHIHCEYPEAPL 230 >ref|XP_012436505.1| PREDICTED: embryogenesis-associated protein EMB8-like isoform X1 [Gossypium raimondii] gi|763780775|gb|KJB47846.1| hypothetical protein B456_008G045200 [Gossypium raimondii] Length = 576 Score = 62.8 bits (151), Expect = 1e-07 Identities = 24/29 (82%), Positives = 29/29 (100%) Frame = -1 Query: 89 SDCFYNAGWTEDVRKVIDHLHCQYPEAPL 3 SDCFYNAG+TED+RK+IDH+HC+YPEAPL Sbjct: 202 SDCFYNAGYTEDLRKLIDHIHCEYPEAPL 230 >ref|XP_006349340.1| PREDICTED: embryogenesis-associated protein EMB8-like [Solanum tuberosum] Length = 579 Score = 62.8 bits (151), Expect = 1e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 89 SDCFYNAGWTEDVRKVIDHLHCQYPEAPL 3 SDCFYNAGWTED R+VIDHLH QYP+APL Sbjct: 199 SDCFYNAGWTEDARRVIDHLHTQYPQAPL 227