BLASTX nr result
ID: Forsythia21_contig00027947
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00027947 (323 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007673518.1| hypothetical protein BAUCODRAFT_31111 [Baudo... 63 9e-08 gb|EMF13224.1| Ubiq_cyt_C_chap-domain-containing protein [Sphaer... 59 2e-06 >ref|XP_007673518.1| hypothetical protein BAUCODRAFT_31111 [Baudoinia compniacensis UAMH 10762] gi|449302836|gb|EMC98844.1| hypothetical protein BAUCODRAFT_31111 [Baudoinia compniacensis UAMH 10762] Length = 324 Score = 62.8 bits (151), Expect = 9e-08 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = -3 Query: 126 LASLRSNSNPIAKATTEPYVAYGATEDLFKACAATCSYTIPA 1 LAS NS P+ + TTEPY+AYG+TEDLF+ACAA CSYT+P+ Sbjct: 75 LASTLRNS-PVLRGTTEPYIAYGSTEDLFRACAAQCSYTVPS 115 >gb|EMF13224.1| Ubiq_cyt_C_chap-domain-containing protein [Sphaerulina musiva SO2202] Length = 330 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = -3 Query: 132 SFLASLRSNSNPIAKATTEPYVAYGATEDLFKACAATCSYTIPA 1 +F A+LRSNS ++TTEPY+AYG+TEDLF C+ CSYTIP+ Sbjct: 74 NFAATLRSNS--ALRSTTEPYIAYGSTEDLFLECSKQCSYTIPS 115