BLASTX nr result
ID: Forsythia21_contig00027868
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00027868 (844 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011095613.1| PREDICTED: small nuclear ribonucleoprotein S... 95 7e-17 ref|XP_010087584.1| hypothetical protein L484_022110 [Morus nota... 94 1e-16 ref|XP_012476196.1| PREDICTED: small nuclear ribonucleoprotein S... 94 1e-16 ref|XP_010929011.1| PREDICTED: small nuclear ribonucleoprotein S... 94 1e-16 gb|KHG18076.1| Small nuclear ribonucleoprotein Sm D1 [Gossypium ... 94 1e-16 gb|KHF99961.1| Small nuclear ribonucleoprotein Sm D1 [Gossypium ... 94 1e-16 ref|XP_010070238.1| PREDICTED: small nuclear ribonucleoprotein S... 94 1e-16 ref|XP_009789901.1| PREDICTED: small nuclear ribonucleoprotein S... 94 1e-16 ref|XP_009587060.1| PREDICTED: small nuclear ribonucleoprotein S... 94 1e-16 ref|XP_008803650.1| PREDICTED: small nuclear ribonucleoprotein S... 94 1e-16 ref|XP_008350062.1| PREDICTED: small nuclear ribonucleoprotein S... 94 1e-16 ref|XP_010252980.1| PREDICTED: small nuclear ribonucleoprotein S... 94 1e-16 emb|CBI32365.3| unnamed protein product [Vitis vinifera] 94 1e-16 ref|XP_002277211.1| PREDICTED: small nuclear ribonucleoprotein S... 94 1e-16 ref|XP_002520764.1| small nuclear ribonucleoprotein sm d1, putat... 94 1e-16 ref|XP_006857628.1| PREDICTED: small nuclear ribonucleoprotein S... 94 1e-16 gb|EMS64609.1| hypothetical protein TRIUR3_26470 [Triticum urartu] 94 1e-16 ref|XP_007201426.1| hypothetical protein PRUPE_ppa013592mg [Prun... 94 1e-16 ref|XP_004242330.1| PREDICTED: small nuclear ribonucleoprotein S... 94 1e-16 gb|AFK42989.1| unknown [Lotus japonicus] 94 1e-16 >ref|XP_011095613.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Sesamum indicum] Length = 114 Score = 94.7 bits (234), Expect = 7e-17 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = +1 Query: 481 KEKNPVTLDHLSVRGNTIRYYILPDSLNLETLLVEETPRVKPKKPTA 621 K KNP+TLDHLSVRGNTIRYYILPDSLNLETLLVEETPRVKPKKPTA Sbjct: 48 KGKNPITLDHLSVRGNTIRYYILPDSLNLETLLVEETPRVKPKKPTA 94 >ref|XP_010087584.1| hypothetical protein L484_022110 [Morus notabilis] gi|587838750|gb|EXB29439.1| hypothetical protein L484_022110 [Morus notabilis] Length = 113 Score = 93.6 bits (231), Expect = 1e-16 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +1 Query: 475 SFKEKNPVTLDHLSVRGNTIRYYILPDSLNLETLLVEETPRVKPKKPTA 621 + K KNPVTLDHLSVRGN IRYYILPDSLNLETLLVEETPRVKPKKPTA Sbjct: 44 TLKGKNPVTLDHLSVRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTA 92 >ref|XP_012476196.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Gossypium raimondii] gi|763758587|gb|KJB25918.1| hypothetical protein B456_004G215800 [Gossypium raimondii] Length = 114 Score = 93.6 bits (231), Expect = 1e-16 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +1 Query: 475 SFKEKNPVTLDHLSVRGNTIRYYILPDSLNLETLLVEETPRVKPKKPTA 621 + K KNPVTLDHLSVRGN IRYYILPDSLNLETLLVEETPRVKPKKPTA Sbjct: 46 TLKGKNPVTLDHLSVRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTA 94 >ref|XP_010929011.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like isoform X2 [Elaeis guineensis] Length = 110 Score = 93.6 bits (231), Expect = 1e-16 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +1 Query: 475 SFKEKNPVTLDHLSVRGNTIRYYILPDSLNLETLLVEETPRVKPKKPTA 621 + K KNPVTLDHLSVRGN IRYYILPDSLNLETLLVEETPRVKPKKPTA Sbjct: 42 TLKGKNPVTLDHLSVRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTA 90 >gb|KHG18076.1| Small nuclear ribonucleoprotein Sm D1 [Gossypium arboreum] Length = 114 Score = 93.6 bits (231), Expect = 1e-16 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +1 Query: 475 SFKEKNPVTLDHLSVRGNTIRYYILPDSLNLETLLVEETPRVKPKKPTA 621 + K KNPVTLDHLSVRGNTIRYYILPDSLNLETLLVEETPRVKPKKP A Sbjct: 46 TLKGKNPVTLDHLSVRGNTIRYYILPDSLNLETLLVEETPRVKPKKPAA 94 >gb|KHF99961.1| Small nuclear ribonucleoprotein Sm D1 [Gossypium arboreum] Length = 114 Score = 93.6 bits (231), Expect = 1e-16 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +1 Query: 475 SFKEKNPVTLDHLSVRGNTIRYYILPDSLNLETLLVEETPRVKPKKPTA 621 + K KNPVTLDHLSVRGN IRYYILPDSLNLETLLVEETPRVKPKKPTA Sbjct: 46 TLKGKNPVTLDHLSVRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTA 94 >ref|XP_010070238.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Eucalyptus grandis] Length = 114 Score = 93.6 bits (231), Expect = 1e-16 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +1 Query: 475 SFKEKNPVTLDHLSVRGNTIRYYILPDSLNLETLLVEETPRVKPKKPTA 621 + K KNPVTLDHLSVRGN IRYYILPDSLNLETLLVEETPRVKPKKPTA Sbjct: 46 TLKGKNPVTLDHLSVRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTA 94 >ref|XP_009789901.1| PREDICTED: small nuclear ribonucleoprotein Sm D1 [Nicotiana sylvestris] Length = 114 Score = 93.6 bits (231), Expect = 1e-16 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +1 Query: 475 SFKEKNPVTLDHLSVRGNTIRYYILPDSLNLETLLVEETPRVKPKKPTA 621 + K KNPVTLDHLSVRGN IRYYILPDSLNLETLLVEETPRVKPKKPTA Sbjct: 46 TLKGKNPVTLDHLSVRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTA 94 >ref|XP_009587060.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Nicotiana tomentosiformis] gi|698534786|ref|XP_009763975.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Nicotiana sylvestris] Length = 114 Score = 93.6 bits (231), Expect = 1e-16 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +1 Query: 475 SFKEKNPVTLDHLSVRGNTIRYYILPDSLNLETLLVEETPRVKPKKPTA 621 + K KNPVTLDHLSVRGN IRYYILPDSLNLETLLVEETPRVKPKKPTA Sbjct: 46 TLKGKNPVTLDHLSVRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTA 94 >ref|XP_008803650.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Phoenix dactylifera] Length = 107 Score = 93.6 bits (231), Expect = 1e-16 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +1 Query: 475 SFKEKNPVTLDHLSVRGNTIRYYILPDSLNLETLLVEETPRVKPKKPTA 621 + K KNPVTLDHLSVRGN IRYYILPDSLNLETLLVEETPRVKPKKPTA Sbjct: 39 TLKGKNPVTLDHLSVRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTA 87 >ref|XP_008350062.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Malus domestica] gi|694332236|ref|XP_009356762.1| PREDICTED: small nuclear ribonucleoprotein Sm D1 [Pyrus x bretschneideri] Length = 114 Score = 93.6 bits (231), Expect = 1e-16 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +1 Query: 475 SFKEKNPVTLDHLSVRGNTIRYYILPDSLNLETLLVEETPRVKPKKPTA 621 + K KNPVTLDHLSVRGN IRYYILPDSLNLETLLVEETPRVKPKKPTA Sbjct: 46 TLKGKNPVTLDHLSVRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTA 94 >ref|XP_010252980.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Nelumbo nucifera] gi|802792617|ref|XP_012092267.1| PREDICTED: small nuclear ribonucleoprotein Sm D1 [Jatropha curcas] gi|643704414|gb|KDP21478.1| hypothetical protein JCGZ_21949 [Jatropha curcas] Length = 114 Score = 93.6 bits (231), Expect = 1e-16 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +1 Query: 475 SFKEKNPVTLDHLSVRGNTIRYYILPDSLNLETLLVEETPRVKPKKPTA 621 + K KNPVTLDHLSVRGN IRYYILPDSLNLETLLVEETPRVKPKKPTA Sbjct: 46 TLKGKNPVTLDHLSVRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTA 94 >emb|CBI32365.3| unnamed protein product [Vitis vinifera] Length = 144 Score = 93.6 bits (231), Expect = 1e-16 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +1 Query: 475 SFKEKNPVTLDHLSVRGNTIRYYILPDSLNLETLLVEETPRVKPKKPTA 621 + K KNPVTLDHLSVRGN IRYYILPDSLNLETLLVEETPRVKPKKPTA Sbjct: 76 TLKGKNPVTLDHLSVRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTA 124 >ref|XP_002277211.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Vitis vinifera] gi|225436988|ref|XP_002277231.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Vitis vinifera] gi|731395359|ref|XP_010652146.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Vitis vinifera] Length = 114 Score = 93.6 bits (231), Expect = 1e-16 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +1 Query: 475 SFKEKNPVTLDHLSVRGNTIRYYILPDSLNLETLLVEETPRVKPKKPTA 621 + K KNPVTLDHLSVRGN IRYYILPDSLNLETLLVEETPRVKPKKPTA Sbjct: 46 TLKGKNPVTLDHLSVRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTA 94 >ref|XP_002520764.1| small nuclear ribonucleoprotein sm d1, putative [Ricinus communis] gi|743807194|ref|XP_010928024.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Elaeis guineensis] gi|223540149|gb|EEF41726.1| small nuclear ribonucleoprotein sm d1, putative [Ricinus communis] Length = 114 Score = 93.6 bits (231), Expect = 1e-16 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +1 Query: 475 SFKEKNPVTLDHLSVRGNTIRYYILPDSLNLETLLVEETPRVKPKKPTA 621 + K KNPVTLDHLSVRGN IRYYILPDSLNLETLLVEETPRVKPKKPTA Sbjct: 46 TLKGKNPVTLDHLSVRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTA 94 >ref|XP_006857628.1| PREDICTED: small nuclear ribonucleoprotein Sm D1 [Amborella trichopoda] gi|743763980|ref|XP_010912191.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Elaeis guineensis] gi|743810858|ref|XP_010929010.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like isoform X1 [Elaeis guineensis] gi|548861724|gb|ERN19095.1| hypothetical protein AMTR_s00061p00127560 [Amborella trichopoda] Length = 114 Score = 93.6 bits (231), Expect = 1e-16 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +1 Query: 475 SFKEKNPVTLDHLSVRGNTIRYYILPDSLNLETLLVEETPRVKPKKPTA 621 + K KNPVTLDHLSVRGN IRYYILPDSLNLETLLVEETPRVKPKKPTA Sbjct: 46 TLKGKNPVTLDHLSVRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTA 94 >gb|EMS64609.1| hypothetical protein TRIUR3_26470 [Triticum urartu] Length = 133 Score = 93.6 bits (231), Expect = 1e-16 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +1 Query: 475 SFKEKNPVTLDHLSVRGNTIRYYILPDSLNLETLLVEETPRVKPKKPTA 621 + K KNPVTLDHLSVRGN IRYYILPDSLNLETLLVEETPRVKPKKPTA Sbjct: 46 TLKGKNPVTLDHLSVRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTA 94 >ref|XP_007201426.1| hypothetical protein PRUPE_ppa013592mg [Prunus persica] gi|645259226|ref|XP_008235260.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Prunus mume] gi|462396826|gb|EMJ02625.1| hypothetical protein PRUPE_ppa013592mg [Prunus persica] Length = 114 Score = 93.6 bits (231), Expect = 1e-16 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +1 Query: 475 SFKEKNPVTLDHLSVRGNTIRYYILPDSLNLETLLVEETPRVKPKKPTA 621 + K KNPVTLDHLSVRGN IRYYILPDSLNLETLLVEETPRVKPKKPTA Sbjct: 46 TLKGKNPVTLDHLSVRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTA 94 >ref|XP_004242330.1| PREDICTED: small nuclear ribonucleoprotein Sm D1 [Solanum lycopersicum] gi|460403318|ref|XP_004247138.1| PREDICTED: small nuclear ribonucleoprotein Sm D1 [Solanum lycopersicum] gi|565372361|ref|XP_006352764.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Solanum tuberosum] Length = 114 Score = 93.6 bits (231), Expect = 1e-16 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +1 Query: 475 SFKEKNPVTLDHLSVRGNTIRYYILPDSLNLETLLVEETPRVKPKKPTA 621 + K KNPVTLDHLSVRGN IRYYILPDSLNLETLLVEETPRVKPKKPTA Sbjct: 46 TLKGKNPVTLDHLSVRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTA 94 >gb|AFK42989.1| unknown [Lotus japonicus] Length = 116 Score = 93.6 bits (231), Expect = 1e-16 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +1 Query: 475 SFKEKNPVTLDHLSVRGNTIRYYILPDSLNLETLLVEETPRVKPKKPTA 621 + K KNPVTLDHLSVRGN IRYYILPDSLNLETLLVEETPRVKPKKPTA Sbjct: 46 TLKGKNPVTLDHLSVRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTA 94