BLASTX nr result
ID: Forsythia21_contig00027697
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00027697 (296 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ88485.1| translocase of outer mitochondrial membrane compl... 56 8e-06 gb|KEQ77906.1| hypothetical protein M436DRAFT_35516 [Aureobasidi... 56 8e-06 >gb|KEQ88485.1| translocase of outer mitochondrial membrane complex, subunit TOM41 [Aureobasidium pullulans EXF-150] Length = 375 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/46 (60%), Positives = 39/46 (84%) Frame = -1 Query: 140 PQVGQLPSLSEKPQSGALSALTNNAVASTIRDTYASFQARREALGL 3 P V + ++EK +SGALSA++NNA+AS ++DTY++FQARREALGL Sbjct: 12 PPVAPVAPVAEK-KSGALSAVSNNALASALKDTYSAFQARREALGL 56 >gb|KEQ77906.1| hypothetical protein M436DRAFT_35516 [Aureobasidium namibiae CBS 147.97] Length = 375 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/46 (60%), Positives = 39/46 (84%) Frame = -1 Query: 140 PQVGQLPSLSEKPQSGALSALTNNAVASTIRDTYASFQARREALGL 3 P V + ++EK +SGALSA++NNA+AS ++DTY++FQARREALGL Sbjct: 12 PPVAPVAPVAEK-KSGALSAVSNNALASALKDTYSAFQARREALGL 56