BLASTX nr result
ID: Forsythia21_contig00027686
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00027686 (343 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009764368.1| PREDICTED: cysteine-rich and transmembrane d... 72 2e-10 ref|XP_009600875.1| PREDICTED: cysteine-rich and transmembrane d... 70 4e-10 emb|CBI30080.3| unnamed protein product [Vitis vinifera] 59 1e-06 ref|XP_002531502.1| conserved hypothetical protein [Ricinus comm... 58 3e-06 ref|XP_006421267.1| hypothetical protein CICLE_v10006402mg [Citr... 58 3e-06 >ref|XP_009764368.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Nicotiana sylvestris] Length = 62 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/58 (60%), Positives = 40/58 (68%), Gaps = 2/58 (3%) Frame = +1 Query: 1 NQPPPGYPTGNAQTGKK-KKMNCWPRTKPKGDGGFCEPKKMARSLFDL-CCWHCDTCF 168 NQPPPGYPT + TGKK KKM C+PR+KPKG+ GF E LF L CCW C+ CF Sbjct: 9 NQPPPGYPTESTPTGKKNKKMKCFPRSKPKGERGFLE-----GCLFALCCCWICEVCF 61 >ref|XP_009600875.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Nicotiana tomentosiformis] Length = 61 Score = 70.5 bits (171), Expect = 4e-10 Identities = 34/58 (58%), Positives = 40/58 (68%), Gaps = 2/58 (3%) Frame = +1 Query: 1 NQPPPGYPTGNAQTGKK-KKMNCWPRTKPKGDGGFCEPKKMARSLFDL-CCWHCDTCF 168 NQPPPGYPT + TGKK KKM C+P++KPKG+ GF E LF L CCW C+ CF Sbjct: 9 NQPPPGYPTESTPTGKKNKKMKCFPKSKPKGERGFLE-----GCLFALCCCWICEVCF 61 >emb|CBI30080.3| unnamed protein product [Vitis vinifera] Length = 56 Score = 59.3 bits (142), Expect = 1e-06 Identities = 31/57 (54%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = +1 Query: 1 NQPPPGYPTGNAQTGKKKKMNCWPRTKPKGDGGFCEPKKMARSLFDL-CCWHCDTCF 168 NQPP GYP N TGK NC PR+K KGD GF E LF L CCW C+ CF Sbjct: 9 NQPPQGYPPANPPTGK----NCCPRSKSKGDRGFIE-----GCLFALCCCWICEACF 56 >ref|XP_002531502.1| conserved hypothetical protein [Ricinus communis] gi|223528889|gb|EEF30889.1| conserved hypothetical protein [Ricinus communis] Length = 56 Score = 57.8 bits (138), Expect = 3e-06 Identities = 32/57 (56%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = +1 Query: 1 NQPPPGYPTGNAQTGKKKKMNCWPRTKPKGDGGFCEPKKMARSLFDL-CCWHCDTCF 168 NQPPPGYPT + T KKK C P TK KGD GF E LF L CCW C+ CF Sbjct: 9 NQPPPGYPT-DTPTAKKK---CCPNTKKKGDRGFIE-----GCLFALCCCWLCEACF 56 >ref|XP_006421267.1| hypothetical protein CICLE_v10006402mg [Citrus clementina] gi|557523140|gb|ESR34507.1| hypothetical protein CICLE_v10006402mg [Citrus clementina] Length = 60 Score = 57.8 bits (138), Expect = 3e-06 Identities = 31/57 (54%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = +1 Query: 1 NQPPPGYPTGNAQTGKKKKMNCWPRTKPKGDGGFCEPKKMARSLFDL-CCWHCDTCF 168 NQPP GYPT N GK KK C +TK KGD GF E LF L CCW C+ CF Sbjct: 10 NQPPAGYPTENPPAGKGKK-KCLSQTKKKGDRGFIE-----GCLFALCCCWLCEACF 60