BLASTX nr result
ID: Forsythia21_contig00027684
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00027684 (630 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009764368.1| PREDICTED: cysteine-rich and transmembrane d... 58 3e-06 ref|XP_009600875.1| PREDICTED: cysteine-rich and transmembrane d... 57 8e-06 >ref|XP_009764368.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Nicotiana sylvestris] Length = 62 Score = 58.2 bits (139), Expect = 3e-06 Identities = 27/38 (71%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Frame = -2 Query: 464 GYLTGNAQTGKK-KKMNCWPRTKPKGDRGFCEGCLFAL 354 GY T + TGKK KKM C+PR+KPKG+RGF EGCLFAL Sbjct: 14 GYPTESTPTGKKNKKMKCFPRSKPKGERGFLEGCLFAL 51 >ref|XP_009600875.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Nicotiana tomentosiformis] Length = 61 Score = 57.0 bits (136), Expect = 8e-06 Identities = 26/38 (68%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Frame = -2 Query: 464 GYLTGNAQTGKK-KKMNCWPRTKPKGDRGFCEGCLFAL 354 GY T + TGKK KKM C+P++KPKG+RGF EGCLFAL Sbjct: 14 GYPTESTPTGKKNKKMKCFPKSKPKGERGFLEGCLFAL 51