BLASTX nr result
ID: Forsythia21_contig00027513
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00027513 (343 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ65108.1| hypothetical protein M437DRAFT_63758 [Aureobasidi... 77 4e-12 >gb|KEQ65108.1| hypothetical protein M437DRAFT_63758 [Aureobasidium melanogenum CBS 110374] Length = 104 Score = 77.0 bits (188), Expect = 4e-12 Identities = 36/58 (62%), Positives = 48/58 (82%) Frame = -2 Query: 183 SQETFYRDQILSNAAVLYHTSFRIVLRQRKTEGKIDFDALLLEGETHKILLGGVPGPH 10 ++ETF+RDQILSNAAVL+ +FRIVLR +K EGK ++A+L++G +HKILL G PG H Sbjct: 2 AEETFFRDQILSNAAVLFPDTFRIVLRAKKQEGKQTYEAVLVDGSSHKILLAGGPGLH 59