BLASTX nr result
ID: Forsythia21_contig00025865
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00025865 (257 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011076193.1| PREDICTED: methyl-CpG-binding domain-contain... 60 6e-07 >ref|XP_011076193.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like isoform X1 [Sesamum indicum] gi|747059609|ref|XP_011076194.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like isoform X2 [Sesamum indicum] Length = 654 Score = 60.1 bits (144), Expect = 6e-07 Identities = 34/84 (40%), Positives = 51/84 (60%) Frame = -1 Query: 257 GDQSSKPVFKGTIMNNANMLEAKQLKPREAEDDSVAGDLGDKLQLVNGKEQLEDRKRQNK 78 GD+ K G +M EA K + DS AG L + L LVN KE L+ +RQ+K Sbjct: 243 GDRRFKSGSVGGAEKKVDMPEANVTKQLKRNFDSAAGSLPNTLPLVNRKEDLKYGRRQSK 302 Query: 77 KLAGNEVEKNVNGDQSLESGTKGA 6 +LA ++++ N++ DQS+ESG++GA Sbjct: 303 RLADSKLKDNISKDQSVESGSEGA 326