BLASTX nr result
ID: Forsythia21_contig00025762
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00025762 (209 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010275322.1| PREDICTED: two-component response regulator-... 66 1e-08 ref|XP_010275321.1| PREDICTED: two-component response regulator-... 66 1e-08 ref|XP_010275320.1| PREDICTED: two-component response regulator-... 66 1e-08 ref|XP_010275314.1| PREDICTED: two-component response regulator-... 66 1e-08 ref|XP_002279150.1| PREDICTED: two-component response regulator-... 64 3e-08 emb|CAN71929.1| hypothetical protein VITISV_001044 [Vitis vinifera] 64 3e-08 ref|XP_011650364.1| PREDICTED: two-component response regulator-... 62 1e-07 ref|XP_011650363.1| PREDICTED: two-component response regulator-... 62 1e-07 ref|XP_011650362.1| PREDICTED: two-component response regulator-... 62 1e-07 ref|XP_011650360.1| PREDICTED: two-component response regulator-... 62 1e-07 ref|XP_011650361.1| PREDICTED: two-component response regulator-... 62 1e-07 ref|XP_008448740.1| PREDICTED: two-component response regulator-... 62 1e-07 ref|XP_008448739.1| PREDICTED: two-component response regulator-... 62 1e-07 ref|XP_008448738.1| PREDICTED: two-component response regulator-... 62 1e-07 ref|XP_008448737.1| PREDICTED: two-component response regulator-... 62 1e-07 ref|XP_008448736.1| PREDICTED: two-component response regulator-... 62 1e-07 ref|XP_012475747.1| PREDICTED: two-component response regulator-... 61 3e-07 gb|KHG08207.1| Two-component response regulator-like APRR2 [Goss... 61 3e-07 ref|XP_009771721.1| PREDICTED: two-component response regulator-... 61 3e-07 emb|CDP12959.1| unnamed protein product [Coffea canephora] 61 3e-07 >ref|XP_010275322.1| PREDICTED: two-component response regulator-like APRR2 isoform X4 [Nelumbo nucifera] Length = 504 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = +3 Query: 84 MACTRNNLLGLKDFPKGLRVLLLDDDKVSALEMRSKLEEMEY 209 M CT ++LLG KDFPKGLRVLLLD+D VSA E++SKLEEM+Y Sbjct: 1 MVCTADDLLGWKDFPKGLRVLLLDEDSVSADEIKSKLEEMDY 42 >ref|XP_010275321.1| PREDICTED: two-component response regulator-like APRR2 isoform X3 [Nelumbo nucifera] Length = 558 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = +3 Query: 84 MACTRNNLLGLKDFPKGLRVLLLDDDKVSALEMRSKLEEMEY 209 M CT ++LLG KDFPKGLRVLLLD+D VSA E++SKLEEM+Y Sbjct: 1 MVCTADDLLGWKDFPKGLRVLLLDEDSVSADEIKSKLEEMDY 42 >ref|XP_010275320.1| PREDICTED: two-component response regulator-like APRR2 isoform X2 [Nelumbo nucifera] Length = 559 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = +3 Query: 84 MACTRNNLLGLKDFPKGLRVLLLDDDKVSALEMRSKLEEMEY 209 M CT ++LLG KDFPKGLRVLLLD+D VSA E++SKLEEM+Y Sbjct: 1 MVCTADDLLGWKDFPKGLRVLLLDEDSVSADEIKSKLEEMDY 42 >ref|XP_010275314.1| PREDICTED: two-component response regulator-like APRR2 isoform X1 [Nelumbo nucifera] gi|720061877|ref|XP_010275315.1| PREDICTED: two-component response regulator-like APRR2 isoform X1 [Nelumbo nucifera] gi|720061880|ref|XP_010275317.1| PREDICTED: two-component response regulator-like APRR2 isoform X1 [Nelumbo nucifera] gi|720061884|ref|XP_010275318.1| PREDICTED: two-component response regulator-like APRR2 isoform X1 [Nelumbo nucifera] gi|720061887|ref|XP_010275319.1| PREDICTED: two-component response regulator-like APRR2 isoform X1 [Nelumbo nucifera] Length = 561 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = +3 Query: 84 MACTRNNLLGLKDFPKGLRVLLLDDDKVSALEMRSKLEEMEY 209 M CT ++LLG KDFPKGLRVLLLD+D VSA E++SKLEEM+Y Sbjct: 1 MVCTADDLLGWKDFPKGLRVLLLDEDSVSADEIKSKLEEMDY 42 >ref|XP_002279150.1| PREDICTED: two-component response regulator-like APRR2 [Vitis vinifera] gi|297742160|emb|CBI33947.3| unnamed protein product [Vitis vinifera] Length = 557 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = +3 Query: 84 MACTRNNLLGLKDFPKGLRVLLLDDDKVSALEMRSKLEEMEY 209 M CT N+L KDFPKGLRVLLLDDD SA E+RSKLEEM+Y Sbjct: 1 MVCTANDLQEWKDFPKGLRVLLLDDDTTSAAEIRSKLEEMDY 42 >emb|CAN71929.1| hypothetical protein VITISV_001044 [Vitis vinifera] Length = 563 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = +3 Query: 84 MACTRNNLLGLKDFPKGLRVLLLDDDKVSALEMRSKLEEMEY 209 M CT N+L KDFPKGLRVLLLDDD SA E+RSKLEEM+Y Sbjct: 1 MVCTANDLQEWKDFPKGLRVLLLDDDTTSAAEIRSKLEEMDY 42 >ref|XP_011650364.1| PREDICTED: two-component response regulator-like APRR2 isoform X5 [Cucumis sativus] Length = 444 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +3 Query: 84 MACTRNNLLGLKDFPKGLRVLLLDDDKVSALEMRSKLEEMEY 209 M CT N+L G KDFPKGLRVLLLD D SA E+++KLEEMEY Sbjct: 1 MVCTANDLHGWKDFPKGLRVLLLDGDTSSAAEIKTKLEEMEY 42 >ref|XP_011650363.1| PREDICTED: two-component response regulator-like APRR2 isoform X4 [Cucumis sativus] Length = 445 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +3 Query: 84 MACTRNNLLGLKDFPKGLRVLLLDDDKVSALEMRSKLEEMEY 209 M CT N+L G KDFPKGLRVLLLD D SA E+++KLEEMEY Sbjct: 1 MVCTANDLHGWKDFPKGLRVLLLDGDTSSAAEIKTKLEEMEY 42 >ref|XP_011650362.1| PREDICTED: two-component response regulator-like APRR2 isoform X3 [Cucumis sativus] Length = 536 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +3 Query: 84 MACTRNNLLGLKDFPKGLRVLLLDDDKVSALEMRSKLEEMEY 209 M CT N+L G KDFPKGLRVLLLD D SA E+++KLEEMEY Sbjct: 1 MVCTANDLHGWKDFPKGLRVLLLDGDTSSAAEIKTKLEEMEY 42 >ref|XP_011650360.1| PREDICTED: two-component response regulator-like APRR2 isoform X1 [Cucumis sativus] Length = 559 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +3 Query: 84 MACTRNNLLGLKDFPKGLRVLLLDDDKVSALEMRSKLEEMEY 209 M CT N+L G KDFPKGLRVLLLD D SA E+++KLEEMEY Sbjct: 1 MVCTANDLHGWKDFPKGLRVLLLDGDTSSAAEIKTKLEEMEY 42 >ref|XP_011650361.1| PREDICTED: two-component response regulator-like APRR2 isoform X2 [Cucumis sativus] gi|700200662|gb|KGN55795.1| hypothetical protein Csa_3G016400 [Cucumis sativus] Length = 558 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +3 Query: 84 MACTRNNLLGLKDFPKGLRVLLLDDDKVSALEMRSKLEEMEY 209 M CT N+L G KDFPKGLRVLLLD D SA E+++KLEEMEY Sbjct: 1 MVCTANDLHGWKDFPKGLRVLLLDGDTSSAAEIKTKLEEMEY 42 >ref|XP_008448740.1| PREDICTED: two-component response regulator-like APRR2 isoform X5 [Cucumis melo] Length = 444 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +3 Query: 84 MACTRNNLLGLKDFPKGLRVLLLDDDKVSALEMRSKLEEMEY 209 M CT N+L G KDFPKGLRVLLLD D SA E+++KLEEMEY Sbjct: 1 MVCTANDLHGWKDFPKGLRVLLLDGDTSSAAEIKTKLEEMEY 42 >ref|XP_008448739.1| PREDICTED: two-component response regulator-like APRR2 isoform X4 [Cucumis melo] Length = 445 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +3 Query: 84 MACTRNNLLGLKDFPKGLRVLLLDDDKVSALEMRSKLEEMEY 209 M CT N+L G KDFPKGLRVLLLD D SA E+++KLEEMEY Sbjct: 1 MVCTANDLHGWKDFPKGLRVLLLDGDTSSAAEIKTKLEEMEY 42 >ref|XP_008448738.1| PREDICTED: two-component response regulator-like APRR2 isoform X3 [Cucumis melo] Length = 536 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +3 Query: 84 MACTRNNLLGLKDFPKGLRVLLLDDDKVSALEMRSKLEEMEY 209 M CT N+L G KDFPKGLRVLLLD D SA E+++KLEEMEY Sbjct: 1 MVCTANDLHGWKDFPKGLRVLLLDGDTSSAAEIKTKLEEMEY 42 >ref|XP_008448737.1| PREDICTED: two-component response regulator-like APRR2 isoform X2 [Cucumis melo] Length = 558 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +3 Query: 84 MACTRNNLLGLKDFPKGLRVLLLDDDKVSALEMRSKLEEMEY 209 M CT N+L G KDFPKGLRVLLLD D SA E+++KLEEMEY Sbjct: 1 MVCTANDLHGWKDFPKGLRVLLLDGDTSSAAEIKTKLEEMEY 42 >ref|XP_008448736.1| PREDICTED: two-component response regulator-like APRR2 isoform X1 [Cucumis melo] Length = 559 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +3 Query: 84 MACTRNNLLGLKDFPKGLRVLLLDDDKVSALEMRSKLEEMEY 209 M CT N+L G KDFPKGLRVLLLD D SA E+++KLEEMEY Sbjct: 1 MVCTANDLHGWKDFPKGLRVLLLDGDTSSAAEIKTKLEEMEY 42 >ref|XP_012475747.1| PREDICTED: two-component response regulator-like APRR2 isoform X1 [Gossypium raimondii] gi|823151837|ref|XP_012475748.1| PREDICTED: two-component response regulator-like APRR2 isoform X1 [Gossypium raimondii] gi|823151839|ref|XP_012475749.1| PREDICTED: two-component response regulator-like APRR2 isoform X1 [Gossypium raimondii] gi|823151841|ref|XP_012475750.1| PREDICTED: two-component response regulator-like APRR2 isoform X1 [Gossypium raimondii] gi|763758048|gb|KJB25379.1| hypothetical protein B456_004G188300 [Gossypium raimondii] gi|763758049|gb|KJB25380.1| hypothetical protein B456_004G188300 [Gossypium raimondii] gi|763758050|gb|KJB25381.1| hypothetical protein B456_004G188300 [Gossypium raimondii] Length = 553 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +3 Query: 84 MACTRNNLLGLKDFPKGLRVLLLDDDKVSALEMRSKLEEMEY 209 M CTRN+L KDFPKGLRVLLLD+D SA E++SKLE M+Y Sbjct: 1 MVCTRNDLSAWKDFPKGLRVLLLDEDTNSAAEIKSKLEAMDY 42 >gb|KHG08207.1| Two-component response regulator-like APRR2 [Gossypium arboreum] Length = 600 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +3 Query: 84 MACTRNNLLGLKDFPKGLRVLLLDDDKVSALEMRSKLEEMEY 209 M CTRN+L KDFPKGLRVLLLD+D SA E++SKLE M+Y Sbjct: 1 MVCTRNDLSAWKDFPKGLRVLLLDEDTNSAAEIKSKLEAMDY 42 >ref|XP_009771721.1| PREDICTED: two-component response regulator-like APRR2 [Nicotiana sylvestris] gi|698559979|ref|XP_009771722.1| PREDICTED: two-component response regulator-like APRR2 [Nicotiana sylvestris] gi|698559982|ref|XP_009771723.1| PREDICTED: two-component response regulator-like APRR2 [Nicotiana sylvestris] gi|698559986|ref|XP_009771724.1| PREDICTED: two-component response regulator-like APRR2 [Nicotiana sylvestris] gi|698559990|ref|XP_009771725.1| PREDICTED: two-component response regulator-like APRR2 [Nicotiana sylvestris] gi|698559993|ref|XP_009771726.1| PREDICTED: two-component response regulator-like APRR2 [Nicotiana sylvestris] Length = 560 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/42 (71%), Positives = 32/42 (76%) Frame = +3 Query: 84 MACTRNNLLGLKDFPKGLRVLLLDDDKVSALEMRSKLEEMEY 209 M CT N LLG DFPKGLRVLLLD D SA EMRS+LE+M Y Sbjct: 1 MVCTENELLGWNDFPKGLRVLLLDKDCNSASEMRSRLEQMNY 42 >emb|CDP12959.1| unnamed protein product [Coffea canephora] Length = 553 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +3 Query: 84 MACTRNNLLGLKDFPKGLRVLLLDDDKVSALEMRSKLEEMEY 209 M CT + LLG KDFPKGL+VLL++ D SA+EMR KLEEM+Y Sbjct: 1 MVCTADELLGWKDFPKGLKVLLIESDACSAVEMRLKLEEMDY 42