BLASTX nr result
ID: Forsythia21_contig00025541
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00025541 (678 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011080439.1| PREDICTED: RNA polymerase II-associated fact... 69 2e-09 >ref|XP_011080439.1| PREDICTED: RNA polymerase II-associated factor 1 homolog [Sesamum indicum] Length = 698 Score = 69.3 bits (168), Expect = 2e-09 Identities = 33/46 (71%), Positives = 36/46 (78%), Gaps = 2/46 (4%) Frame = -3 Query: 178 NQFSQNWDTYSGKEGSAYNQNYAQMNLSSNYQHAGYGSSS--QQHF 47 NQ+SQNW YSG EGS YNQNY+Q N SSNY +GYGSSS QQHF Sbjct: 41 NQYSQNWGPYSGNEGSNYNQNYSQTNPSSNYPGSGYGSSSSQQQHF 86