BLASTX nr result
ID: Forsythia21_contig00024990
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00024990 (623 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535142.1| conserved hypothetical protein [Ricinus comm... 78 1e-18 ref|XP_010095217.1| hypothetical protein L484_003934 [Morus nota... 45 2e-07 >ref|XP_002535142.1| conserved hypothetical protein [Ricinus communis] gi|223523947|gb|EEF27248.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 77.8 bits (190), Expect(2) = 1e-18 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +3 Query: 480 EKGAVIYLDQFPEALEIQTGSENHWRLWRPSFRQQRSHP 596 E+ AVIYLDQFPEALEIQTGSENHWRL RPSFRQQRSHP Sbjct: 28 EERAVIYLDQFPEALEIQTGSENHWRLRRPSFRQQRSHP 66 Score = 42.7 bits (99), Expect(2) = 1e-18 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +1 Query: 397 RGFGSLYFRAGREVKAIREDCPPGKEE 477 RG G YF REVKAIREDCPPGKEE Sbjct: 4 RGAG-FYFLTEREVKAIREDCPPGKEE 29 >ref|XP_010095217.1| hypothetical protein L484_003934 [Morus notabilis] gi|587869360|gb|EXB58678.1| hypothetical protein L484_003934 [Morus notabilis] Length = 78 Score = 45.1 bits (105), Expect(2) = 2e-07 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +3 Query: 501 LDQFPEALEIQTGSENHWR 557 LDQFPEALEIQTGSENHWR Sbjct: 42 LDQFPEALEIQTGSENHWR 60 Score = 37.0 bits (84), Expect(2) = 2e-07 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 568 LRFANKEVILDNFPFLP 618 LRFANKEVILD+FPFLP Sbjct: 62 LRFANKEVILDDFPFLP 78