BLASTX nr result
ID: Forsythia21_contig00024969
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00024969 (409 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002482271.1| ribosomal protein L39e, putative [Talaromyce... 115 2e-23 ref|XP_002848813.1| hypothetical protein MCYG_01747 [Arthroderma... 114 3e-23 ref|XP_002544670.1| predicted protein [Uncinocarpus reesii 1704]... 112 1e-22 emb|CCT65955.1| probable RPL39-60S large subunit ribosomal prote... 111 2e-22 ref|XP_001931434.1| 60S ribosomal protein L39 [Pyrenophora triti... 109 8e-22 emb|CEF83650.1| unnamed protein product [Fusarium graminearum] 108 1e-21 ref|XP_001799583.1| hypothetical protein SNOG_09286 [Phaeosphaer... 108 1e-21 ref|XP_001242303.1| 60S ribosomal protein L39 [Coccidioides immi... 108 2e-21 ref|XP_001559308.1| 60S ribosomal protein L39 [Botrytis cinerea ... 107 2e-21 ref|XP_001542836.1| 60S ribosomal protein L39 [Histoplasma capsu... 106 7e-21 gb|KEY67153.1| hypothetical protein S7711_03013 [Stachybotrys ch... 105 9e-21 gb|KFY76831.1| hypothetical protein V499_03609 [Pseudogymnoascus... 105 1e-20 emb|CCX04754.1| Protein of unknown function [Pyronema omphalodes... 105 1e-20 emb|CCU76647.1| 60S ribosomal protein L39 [Blumeria graminis f. ... 105 1e-20 ref|XP_003850033.1| 60S ribosomal protein L39 [Zymoseptoria trit... 105 1e-20 gb|EPS27305.1| hypothetical protein PDE_02248 [Penicillium oxali... 105 2e-20 ref|XP_003189071.1| 60S ribosomal protein L39 [Aspergillus oryza... 105 2e-20 ref|XP_003844630.1| similar to 60S ribosomal protein L39 [Leptos... 105 2e-20 ref|XP_003051759.1| 60S ribosomal protein L39 [Nectria haematoco... 105 2e-20 ref|XP_007675548.1| hypothetical protein BAUCODRAFT_147112 [Baud... 104 2e-20 >ref|XP_002482271.1| ribosomal protein L39e, putative [Talaromyces stipitatus ATCC 10500] gi|218718859|gb|EED18279.1| ribosomal protein L39e, putative [Talaromyces stipitatus ATCC 10500] Length = 109 Score = 115 bits (287), Expect = 2e-23 Identities = 53/56 (94%), Positives = 56/56 (100%) Frame = -1 Query: 391 QQAVKMPSQKSFRTKQKLARAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 224 +QA+KMPSQKSFRTKQKLA+AQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI Sbjct: 54 RQAIKMPSQKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 109 >ref|XP_002848813.1| hypothetical protein MCYG_01747 [Arthroderma otae CBS 113480] gi|238839266|gb|EEQ28928.1| hypothetical protein MCYG_01747 [Arthroderma otae CBS 113480] Length = 94 Score = 114 bits (285), Expect = 3e-23 Identities = 53/57 (92%), Positives = 56/57 (98%) Frame = -1 Query: 394 SQQAVKMPSQKSFRTKQKLARAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 224 S ++VKMPSQKSFRTKQKLA+AQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI Sbjct: 38 SSESVKMPSQKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 94 >ref|XP_002544670.1| predicted protein [Uncinocarpus reesii 1704] gi|237904940|gb|EEP79341.1| predicted protein [Uncinocarpus reesii 1704] Length = 183 Score = 112 bits (279), Expect = 1e-22 Identities = 52/57 (91%), Positives = 55/57 (96%) Frame = -1 Query: 394 SQQAVKMPSQKSFRTKQKLARAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 224 ++ VKMPSQKSFRTKQKLA+AQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI Sbjct: 127 NKNPVKMPSQKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 183 >emb|CCT65955.1| probable RPL39-60S large subunit ribosomal protein L39.e [Fusarium fujikuroi IMI 58289] Length = 93 Score = 111 bits (277), Expect = 2e-22 Identities = 51/60 (85%), Positives = 56/60 (93%) Frame = -1 Query: 403 SDYSQQAVKMPSQKSFRTKQKLARAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 224 +D + AVKMPS KSFRTKQKLA+AQKQNRP+PQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 34 TDSTINAVKMPSHKSFRTKQKLAKAQKQNRPVPQWIRLRTGNTIRYNAKRRHWRKTRIGI 93 >ref|XP_001931434.1| 60S ribosomal protein L39 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|330935615|ref|XP_003305050.1| 60S ribosomal protein L39 [Pyrenophora teres f. teres 0-1] gi|187973040|gb|EDU40539.1| 60S ribosomal protein L39 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|311318083|gb|EFQ86842.1| hypothetical protein PTT_17793 [Pyrenophora teres f. teres 0-1] Length = 51 Score = 109 bits (272), Expect = 8e-22 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -1 Query: 376 MPSQKSFRTKQKLARAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 224 MPSQKSFRTKQKLARAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI Sbjct: 1 MPSQKSFRTKQKLARAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >emb|CEF83650.1| unnamed protein product [Fusarium graminearum] Length = 68 Score = 108 bits (271), Expect = 1e-21 Identities = 50/60 (83%), Positives = 55/60 (91%) Frame = -1 Query: 403 SDYSQQAVKMPSQKSFRTKQKLARAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 224 +D + AV MPS KSFRTKQKLA+AQKQNRP+PQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 9 TDSTINAVTMPSHKSFRTKQKLAKAQKQNRPVPQWIRLRTGNTIRYNAKRRHWRKTRIGI 68 >ref|XP_001799583.1| hypothetical protein SNOG_09286 [Phaeosphaeria nodorum SN15] gi|160702486|gb|EAT83478.2| hypothetical protein SNOG_09286 [Phaeosphaeria nodorum SN15] Length = 95 Score = 108 bits (271), Expect = 1e-21 Identities = 52/59 (88%), Positives = 52/59 (88%) Frame = -1 Query: 400 DYSQQAVKMPSQKSFRTKQKLARAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 224 D V MPSQKSFRTKQKLARAQKQNRPIPQWIRLRT NTIRYNAKRRHWRKTRLGI Sbjct: 37 DIPTPVVTMPSQKSFRTKQKLARAQKQNRPIPQWIRLRTNNTIRYNAKRRHWRKTRLGI 95 >ref|XP_001242303.1| 60S ribosomal protein L39 [Coccidioides immitis RS] gi|303319107|ref|XP_003069553.1| 60S ribosomal protein L39 [Coccidioides posadasii C735 delta SOWgp] gi|627829171|ref|XP_007686227.1| hypothetical protein COCMIDRAFT_3805 [Bipolaris oryzae ATCC 44560] gi|628063828|ref|XP_007697307.1| hypothetical protein COCSADRAFT_111781 [Bipolaris sorokiniana ND90Pr] gi|628186630|ref|XP_007707561.1| hypothetical protein COCCADRAFT_1122 [Bipolaris zeicola 26-R-13] gi|240109239|gb|EER27408.1| 60S ribosomal protein L39, putative [Coccidioides posadasii C735 delta SOWgp] gi|320041052|gb|EFW22985.1| hypothetical protein CPSG_00884 [Coccidioides posadasii str. Silveira] gi|451854430|gb|EMD67723.1| hypothetical protein COCSADRAFT_111781 [Bipolaris sorokiniana ND90Pr] gi|451999507|gb|EMD91969.1| hypothetical protein COCHEDRAFT_1223922 [Bipolaris maydis C5] gi|576923975|gb|EUC38088.1| hypothetical protein COCCADRAFT_1122 [Bipolaris zeicola 26-R-13] gi|576933721|gb|EUC47244.1| hypothetical protein COCMIDRAFT_3805 [Bipolaris oryzae ATCC 44560] gi|578492993|gb|EUN30389.1| hypothetical protein COCVIDRAFT_23909 [Bipolaris victoriae FI3] gi|679991665|gb|KFX44403.1| 60S ribosomal protein L39 [Talaromyces marneffei PM1] gi|767017100|gb|EAS30720.3| 60S ribosomal protein L39 [Coccidioides immitis RS] gi|855532077|gb|KMM67224.1| hypothetical protein CPAG_03559 [Coccidioides posadasii RMSCC 3488] gi|859408747|gb|KMP03296.1| hypothetical protein CIRG_02988 [Coccidioides immitis RMSCC 2394] gi|875286628|gb|KMU80282.1| hypothetical protein CISG_08388 [Coccidioides immitis RMSCC 3703] gi|875637869|gb|KMU84880.1| hypothetical protein CIHG_02663 [Coccidioides immitis H538.4] Length = 51 Score = 108 bits (269), Expect = 2e-21 Identities = 50/51 (98%), Positives = 51/51 (100%) Frame = -1 Query: 376 MPSQKSFRTKQKLARAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 224 MPSQKSFRTKQKLA+AQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI Sbjct: 1 MPSQKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >ref|XP_001559308.1| 60S ribosomal protein L39 [Botrytis cinerea B05.10] gi|156065067|ref|XP_001598455.1| 60S ribosomal protein L39 [Sclerotinia sclerotiorum 1980 UF-70] gi|154691403|gb|EDN91141.1| 60S ribosomal protein L39 [Sclerotinia sclerotiorum 1980 UF-70] gi|347828316|emb|CCD44013.1| similar to 60S ribosomal protein L39 [Botrytis cinerea T4] Length = 51 Score = 107 bits (268), Expect = 2e-21 Identities = 49/51 (96%), Positives = 51/51 (100%) Frame = -1 Query: 376 MPSQKSFRTKQKLARAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 224 MPSQKSFRTKQKLARAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTR+G+ Sbjct: 1 MPSQKSFRTKQKLARAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGL 51 >ref|XP_001542836.1| 60S ribosomal protein L39 [Histoplasma capsulatum NAm1] gi|327292414|ref|XP_003230906.1| 60S ribosomal protein L39 [Trichophyton rubrum CBS 118892] gi|389629646|ref|XP_003712476.1| 60S ribosomal protein L39 [Magnaporthe oryzae 70-15] gi|615467304|ref|XP_007599880.1| hypothetical protein CFIO01_13564 [Colletotrichum fioriniae PJ7] gi|636583219|ref|XP_008022948.1| hypothetical protein SETTUDRAFT_46231 [Setosphaeria turcica Et28A] gi|685402138|ref|XP_009219929.1| 60S ribosomal protein L39 [Gaeumannomyces graminis var. tritici R3-111a-1] gi|150411016|gb|EDN06404.1| ribosomal protein L39 [Histoplasma capsulatum NAm1] gi|259487695|tpe|CBF86564.1| TPA: conserved hypothetical protein [Aspergillus nidulans FGSC A4] gi|351644808|gb|EHA52669.1| 60S ribosomal protein L39 [Magnaporthe oryzae 70-15] gi|402083766|gb|EJT78784.1| 60S ribosomal protein L39 [Gaeumannomyces graminis var. tritici R3-111a-1] gi|440475962|gb|ELQ44608.1| hypothetical protein OOU_Y34scaffold00071g24 [Magnaporthe oryzae Y34] gi|440487781|gb|ELQ67556.1| hypothetical protein OOW_P131scaffold00314g129 [Magnaporthe oryzae P131] gi|482812667|gb|EOA89386.1| hypothetical protein SETTUDRAFT_46231 [Setosphaeria turcica Et28A] gi|550808028|gb|ERS99941.1| 60S ribosomal protein L39 [Sporothrix schenckii ATCC 58251] gi|588894534|gb|EXF76478.1| hypothetical protein CFIO01_13564 [Colletotrichum fioriniae PJ7] gi|607883430|gb|EZF28033.1| 60S ribosomal protein L39 [Trichophyton rubrum MR850] gi|607910227|gb|EZF47097.1| 60S ribosomal protein L39 [Trichophyton rubrum CBS 100081] gi|607922284|gb|EZF57748.1| 60S ribosomal protein L39 [Trichophyton rubrum CBS 288.86] gi|607934286|gb|EZF68319.1| 60S ribosomal protein L39 [Trichophyton rubrum CBS 289.86] gi|607946260|gb|EZF79023.1| 60S ribosomal protein L39 [Trichophyton soudanense CBS 452.61] gi|607958340|gb|EZF89637.1| 60S ribosomal protein L39 [Trichophyton rubrum MR1448] gi|607970581|gb|EZG00476.1| 60S ribosomal protein L39 [Trichophyton rubrum MR1459] gi|607976489|gb|EZG05683.1| 60S ribosomal protein L39 [Trichophyton rubrum CBS 735.88] gi|607994655|gb|EZG22078.1| 60S ribosomal protein L39 [Trichophyton rubrum CBS 202.88] gi|633064723|gb|KDB38828.1| 60S ribosomal protein L39 [Trichophyton rubrum D6] gi|835888956|gb|KLU81216.1| 60S ribosomal protein L39 [Magnaporthiopsis poae ATCC 64411] Length = 51 Score = 106 bits (264), Expect = 7e-21 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = -1 Query: 376 MPSQKSFRTKQKLARAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 224 MPS KSFRTKQKLA+AQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI Sbjct: 1 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >gb|KEY67153.1| hypothetical protein S7711_03013 [Stachybotrys chartarum IBT 7711] gi|667517347|gb|KFA46797.1| hypothetical protein S40293_06785 [Stachybotrys chartarum IBT 40293] gi|667735668|gb|KFA75011.1| hypothetical protein S40288_02227 [Stachybotrys chartarum IBT 40288] Length = 51 Score = 105 bits (263), Expect = 9e-21 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = -1 Query: 376 MPSQKSFRTKQKLARAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 224 MPS KSFRTKQKLA+AQKQNRP+PQWIRLRTGNTIRYNAKRRHWRKTRLGI Sbjct: 1 MPSHKSFRTKQKLAKAQKQNRPVPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >gb|KFY76831.1| hypothetical protein V499_03609 [Pseudogymnoascus pannorum VKM F-103] Length = 89 Score = 105 bits (262), Expect = 1e-20 Identities = 48/57 (84%), Positives = 53/57 (92%) Frame = -1 Query: 394 SQQAVKMPSQKSFRTKQKLARAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 224 ++Q+ KMPS KSFRTK KLA+AQK NRPIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 33 TRQSFKMPSHKSFRTKVKLAKAQKSNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 89 >emb|CCX04754.1| Protein of unknown function [Pyronema omphalodes CBS 100304] Length = 51 Score = 105 bits (262), Expect = 1e-20 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = -1 Query: 376 MPSQKSFRTKQKLARAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 224 MPSQKSFRTK KLA+AQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI Sbjct: 1 MPSQKSFRTKVKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >emb|CCU76647.1| 60S ribosomal protein L39 [Blumeria graminis f. sp. hordei DH14] Length = 51 Score = 105 bits (262), Expect = 1e-20 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = -1 Query: 376 MPSQKSFRTKQKLARAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 224 MPS KSFRTKQKLARAQKQNRPIPQWIRLRTGNTIRYN+KRRHWRKTR+GI Sbjct: 1 MPSHKSFRTKQKLARAQKQNRPIPQWIRLRTGNTIRYNSKRRHWRKTRIGI 51 >ref|XP_003850033.1| 60S ribosomal protein L39 [Zymoseptoria tritici IPO323] gi|667834302|ref|XP_007781320.1| 60S ribosomal protein L39 [Coniosporium apollinis CBS 100218] gi|339469911|gb|EGP85009.1| hypothetical protein MYCGRDRAFT_105463 [Zymoseptoria tritici IPO323] gi|494829312|gb|EON66003.1| 60S ribosomal protein L39 [Coniosporium apollinis CBS 100218] gi|751758072|gb|KIN06246.1| hypothetical protein OIDMADRAFT_38580 [Oidiodendron maius Zn] gi|752278391|dbj|GAM86723.1| hypothetical protein ANO11243_047420 [fungal sp. No.11243] gi|796708356|gb|KJX99510.1| 60S ribosomal protein L39 [Zymoseptoria brevis] Length = 51 Score = 105 bits (262), Expect = 1e-20 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = -1 Query: 376 MPSQKSFRTKQKLARAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 224 MPS KSFRTKQKLA+AQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 1 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >gb|EPS27305.1| hypothetical protein PDE_02248 [Penicillium oxalicum 114-2] Length = 51 Score = 105 bits (261), Expect = 2e-20 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = -1 Query: 376 MPSQKSFRTKQKLARAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 224 MPS K+FRTKQKLA+AQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI Sbjct: 1 MPSHKTFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >ref|XP_003189071.1| 60S ribosomal protein L39 [Aspergillus oryzae RIB40] Length = 51 Score = 105 bits (261), Expect = 2e-20 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = -1 Query: 376 MPSQKSFRTKQKLARAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 224 MPS KSFRTKQKLA+AQ+QNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI Sbjct: 1 MPSHKSFRTKQKLAKAQRQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >ref|XP_003844630.1| similar to 60S ribosomal protein L39 [Leptosphaeria maculans JN3] gi|312221210|emb|CBY01151.1| similar to 60S ribosomal protein L39 [Leptosphaeria maculans JN3] Length = 51 Score = 105 bits (261), Expect = 2e-20 Identities = 49/51 (96%), Positives = 49/51 (96%) Frame = -1 Query: 376 MPSQKSFRTKQKLARAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 224 MPS KSFRTKQKLARAQKQNRPIPQWIRLRT NTIRYNAKRRHWRKTRLGI Sbjct: 1 MPSHKSFRTKQKLARAQKQNRPIPQWIRLRTNNTIRYNAKRRHWRKTRLGI 51 >ref|XP_003051759.1| 60S ribosomal protein L39 [Nectria haematococca mpVI 77-13-4] gi|685872197|ref|XP_009263131.1| hypothetical protein FPSE_11739 [Fusarium pseudograminearum CS3096] gi|758208834|ref|XP_011326588.1| hypothetical protein FGSG_06921 [Fusarium graminearum PH-1] gi|256732698|gb|EEU46046.1| predicted protein [Nectria haematococca mpVI 77-13-4] gi|342865967|gb|EGU71968.1| hypothetical protein FOXB_17529 [Fusarium oxysporum Fo5176] gi|408388242|gb|EKJ67928.1| hypothetical protein FPSE_11739 [Fusarium pseudograminearum CS3096] gi|558862998|gb|ESU13081.1| hypothetical protein FGSG_06921 [Fusarium graminearum PH-1] gi|584139211|gb|EWG48551.1| 60S ribosomal protein L39 [Fusarium verticillioides 7600] gi|587676271|gb|EWY98599.1| 60S ribosomal protein L39 [Fusarium oxysporum FOSC 3-a] gi|587698070|gb|EWZ44675.1| 60S ribosomal protein L39 [Fusarium oxysporum Fo47] gi|587727111|gb|EWZ98448.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. lycopersici MN25] gi|587752242|gb|EXA49958.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. pisi HDV247] gi|590040183|gb|EXK42041.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. melonis 26406] gi|590073088|gb|EXL00613.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. raphani 54005] gi|591426865|gb|EXL62002.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591453858|gb|EXL86129.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591463667|gb|EXL95148.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591507348|gb|EXM36611.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. vasinfectum 25433] gi|596543402|gb|EYB23707.1| hypothetical protein FG05_06921 [Fusarium graminearum] gi|829113621|gb|KLO90055.1| putative RPL39-60S large subunit ribosomal protein L39.e [Fusarium fujikuroi] gi|829136452|gb|KLP09859.1| putative RPL39-60S large subunit ribosomal protein L39.e [Fusarium fujikuroi] gi|829151008|gb|KLP19369.1| putative RPL39-60S large subunit ribosomal protein L39.e [Fusarium fujikuroi] Length = 51 Score = 105 bits (261), Expect = 2e-20 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = -1 Query: 376 MPSQKSFRTKQKLARAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 224 MPS KSFRTKQKLA+AQKQNRP+PQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 1 MPSHKSFRTKQKLAKAQKQNRPVPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >ref|XP_007675548.1| hypothetical protein BAUCODRAFT_147112 [Baudoinia compniacensis UAMH 10762] gi|449300902|gb|EMC96913.1| hypothetical protein BAUCODRAFT_147112 [Baudoinia compniacensis UAMH 10762] Length = 51 Score = 104 bits (260), Expect = 2e-20 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = -1 Query: 376 MPSQKSFRTKQKLARAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 224 MPS KSFRTKQKLA+AQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTR+G+ Sbjct: 1 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGL 51