BLASTX nr result
ID: Forsythia21_contig00024844
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00024844 (305 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011087267.1| PREDICTED: putative glycosyltransferase 5 [S... 65 1e-08 ref|XP_011072798.1| PREDICTED: putative glycosyltransferase 5 [S... 58 2e-06 ref|XP_012839339.1| PREDICTED: putative glycosyltransferase 5 [E... 57 4e-06 emb|CAI11457.1| putative glycosyltransferase [Solanum tuberosum] 56 8e-06 >ref|XP_011087267.1| PREDICTED: putative glycosyltransferase 5 [Sesamum indicum] gi|747080066|ref|XP_011087268.1| PREDICTED: putative glycosyltransferase 5 [Sesamum indicum] Length = 453 Score = 65.5 bits (158), Expect = 1e-08 Identities = 33/43 (76%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = -2 Query: 127 MGSDSTFAAQKRASGGLPTTVATAN-GVRGRAASVIPRGRQIH 2 MGS+STF+AQKR S GLPTT ATAN G R RAAS++PRGRQIH Sbjct: 1 MGSESTFSAQKRGSSGLPTTGATANGGARARAASLLPRGRQIH 43 >ref|XP_011072798.1| PREDICTED: putative glycosyltransferase 5 [Sesamum indicum] Length = 475 Score = 58.2 bits (139), Expect = 2e-06 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -2 Query: 130 LMGSDSTFAAQKRASGGLPTTVATANGVRGRAASVIPRGRQIH 2 LMGS+STF+AQKR +G LPTT ATA RGRAAS +PRGRQ++ Sbjct: 23 LMGSESTFSAQKRNTGVLPTTTATA--ARGRAASTLPRGRQMN 63 >ref|XP_012839339.1| PREDICTED: putative glycosyltransferase 5 [Erythranthe guttatus] gi|604330899|gb|EYU35800.1| hypothetical protein MIMGU_mgv1a006038mg [Erythranthe guttata] Length = 460 Score = 57.4 bits (137), Expect = 4e-06 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 4/46 (8%) Frame = -2 Query: 127 MGSDSTFAAQKRASGGLPTTVATAN----GVRGRAASVIPRGRQIH 2 MGS+STF+AQKR SG LPTTV+TAN G R +AS+IPRGRQ++ Sbjct: 1 MGSESTFSAQKRTSGTLPTTVSTANGGSRGGRSSSASLIPRGRQMN 46 >emb|CAI11457.1| putative glycosyltransferase [Solanum tuberosum] Length = 474 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -2 Query: 127 MGSDSTFAAQKRASGGLPTTVATANGVRGRAASVIPRGRQIH 2 MG +STF AQKRA G LPTTV GVRGR+ +V+PRGRQI+ Sbjct: 1 MGQESTFTAQKRA-GALPTTVTANGGVRGRSPNVLPRGRQIN 41