BLASTX nr result
ID: Forsythia21_contig00024785
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00024785 (325 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD87425.1| hypothetical protein COCHEDRAFT_1145041 [Bipolari... 72 1e-10 ref|XP_007705102.1| hypothetical protein COCSADRAFT_347929 [Bipo... 71 3e-10 gb|EUN28534.1| hypothetical protein COCVIDRAFT_95404 [Bipolaris ... 70 4e-10 ref|XP_007711755.1| hypothetical protein COCCADRAFT_36305 [Bipol... 70 4e-10 ref|XP_007692722.1| hypothetical protein COCMIDRAFT_107963 [Bipo... 67 5e-09 ref|XP_001936929.1| retinol dehydrogenase 12 [Pyrenophora tritic... 59 2e-06 >gb|EMD87425.1| hypothetical protein COCHEDRAFT_1145041 [Bipolaris maydis C5] gi|477589549|gb|ENI06625.1| hypothetical protein COCC4DRAFT_133903 [Bipolaris maydis ATCC 48331] Length = 344 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -2 Query: 324 NPVKGVWLEDNQLGHPVSWAVDEKKAEMLWKLSEEMIVEKL 202 NP KGVWLEDNQL PV+WAVD++KAE LWKLSEE+I EKL Sbjct: 302 NPEKGVWLEDNQLAEPVAWAVDKEKAERLWKLSEEIIAEKL 342 >ref|XP_007705102.1| hypothetical protein COCSADRAFT_347929 [Bipolaris sorokiniana ND90Pr] gi|451846065|gb|EMD59376.1| hypothetical protein COCSADRAFT_347929 [Bipolaris sorokiniana ND90Pr] Length = 339 Score = 70.9 bits (172), Expect = 3e-10 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -2 Query: 324 NPVKGVWLEDNQLGHPVSWAVDEKKAEMLWKLSEEMIVEKL 202 NP KGVWLEDNQL PV+WAVD++KAE LWKLSE++I EKL Sbjct: 297 NPEKGVWLEDNQLAEPVTWAVDKEKAERLWKLSEKIITEKL 337 >gb|EUN28534.1| hypothetical protein COCVIDRAFT_95404 [Bipolaris victoriae FI3] Length = 339 Score = 70.5 bits (171), Expect = 4e-10 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -2 Query: 324 NPVKGVWLEDNQLGHPVSWAVDEKKAEMLWKLSEEMIVEKL 202 NP KGVWLEDNQL PV+WAVD++KAE LWKLSE++I EKL Sbjct: 297 NPEKGVWLEDNQLVEPVAWAVDQEKAERLWKLSEDIIAEKL 337 >ref|XP_007711755.1| hypothetical protein COCCADRAFT_36305 [Bipolaris zeicola 26-R-13] gi|576919783|gb|EUC33951.1| hypothetical protein COCCADRAFT_36305 [Bipolaris zeicola 26-R-13] Length = 339 Score = 70.5 bits (171), Expect = 4e-10 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -2 Query: 324 NPVKGVWLEDNQLGHPVSWAVDEKKAEMLWKLSEEMIVEKL 202 NP KGVWLEDNQL PV+WAVD++KAE LWKLSE++I EKL Sbjct: 297 NPEKGVWLEDNQLVEPVAWAVDQEKAERLWKLSEDIIAEKL 337 >ref|XP_007692722.1| hypothetical protein COCMIDRAFT_107963 [Bipolaris oryzae ATCC 44560] gi|576927045|gb|EUC40754.1| hypothetical protein COCMIDRAFT_107963 [Bipolaris oryzae ATCC 44560] Length = 339 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -2 Query: 324 NPVKGVWLEDNQLGHPVSWAVDEKKAEMLWKLSEEMIVEKL 202 NP KGVWLEDN L PV+W VD+ KAE LWKLSE++I EKL Sbjct: 297 NPEKGVWLEDNHLAEPVAWGVDKNKAERLWKLSEKIIAEKL 337 >ref|XP_001936929.1| retinol dehydrogenase 12 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187984028|gb|EDU49516.1| retinol dehydrogenase 12 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 345 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -2 Query: 324 NPVKGVWLEDNQLGHPVSWAVDEKKAEMLWKLSEEMIVEKL 202 +P KGVWL D QL P WAV+E+KAE LWKLSEE +VEKL Sbjct: 304 SPEKGVWLSDCQLAEPAEWAVNEEKAERLWKLSEE-LVEKL 343