BLASTX nr result
ID: Forsythia21_contig00024723
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00024723 (477 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMF09245.1| hypothetical protein SEPMUDRAFT_151343 [Sphaeruli... 60 7e-07 >gb|EMF09245.1| hypothetical protein SEPMUDRAFT_151343 [Sphaerulina musiva SO2202] Length = 163 Score = 59.7 bits (143), Expect = 7e-07 Identities = 38/100 (38%), Positives = 48/100 (48%), Gaps = 8/100 (8%) Frame = -1 Query: 282 STDTQTYGSFFVNKFVFGCTAGCYYSFDVSFTTSDEQS-------QCSGSLED-KDYVEC 127 S T G+F + FVFGCT C Y+FD++ T S E +CSGSL+ DYVEC Sbjct: 35 SNTNLTPGTFSITNFVFGCTVNCSYNFDLAVTGSAENHPAVKKPVKCSGSLDSTTDYVEC 94 Query: 126 KGKETGASYSAYIDTTSGSNILKLQYTVNNYPNEGTTTHF 7 AYI +N LKLQY V N ++ Sbjct: 95 GYVSKTQKLYAYI--VKDTNELKLQYEVQRPKNSAVYKYY 132