BLASTX nr result
ID: Forsythia21_contig00024721
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00024721 (272 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME47858.1| hypothetical protein DOTSEDRAFT_51158 [Dothistrom... 56 8e-06 >gb|EME47858.1| hypothetical protein DOTSEDRAFT_51158 [Dothistroma septosporum NZE10] Length = 192 Score = 56.2 bits (134), Expect = 8e-06 Identities = 35/86 (40%), Positives = 46/86 (53%), Gaps = 8/86 (9%) Frame = -3 Query: 240 FFVNKFVFGCTAGCYYSFDV-------SFTTADEQFECSGSLED-KDYVDCKGKESGASY 85 F V +FVFGCT GCY++F V + + ECSGSL+D KDYVDC + Sbjct: 73 FAVTEFVFGCTDGCYWNFKVAVQGEGPNHPPVQKPVECSGSLDDNKDYVDCGEISKTQTI 132 Query: 84 SSYIDTTSGSNILKLQYTVNNYPNEG 7 +YI +N L L+Y V P +G Sbjct: 133 RAYI--VKATNELMLKYEVQK-PKQG 155