BLASTX nr result
ID: Forsythia21_contig00024706
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00024706 (405 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011101556.1| PREDICTED: molybdopterin synthase sulfur car... 124 3e-26 ref|XP_002525500.1| conserved hypothetical protein [Ricinus comm... 122 9e-26 ref|XP_006478433.1| PREDICTED: molybdopterin synthase sulfur car... 119 8e-25 ref|XP_006441691.1| hypothetical protein CICLE_v10022992mg [Citr... 119 8e-25 ref|XP_012854939.1| PREDICTED: molybdopterin synthase sulfur car... 117 4e-24 ref|XP_002274036.1| PREDICTED: molybdopterin synthase sulfur car... 115 9e-24 ref|XP_002325503.1| molybdenum cofactor synthesis family protein... 115 9e-24 ref|NP_001238656.1| uncharacterized protein LOC100527353 [Glycin... 115 9e-24 ref|XP_011008177.1| PREDICTED: molybdopterin synthase sulfur car... 115 1e-23 ref|XP_007200636.1| hypothetical protein PRUPE_ppa013746mg [Prun... 115 1e-23 ref|XP_008237751.1| PREDICTED: molybdopterin synthase sulfur car... 114 2e-23 ref|XP_007019912.1| Cell wall / vacuolar inhibitor of fructosida... 114 2e-23 ref|XP_007019911.1| Cell wall / vacuolar inhibitor of fructosida... 114 2e-23 gb|AFK35775.1| unknown [Medicago truncatula] gi|657391696|gb|AES... 113 4e-23 ref|XP_003598217.1| Molybdopterin synthase sulfur carrier subuni... 113 4e-23 ref|XP_012076932.1| PREDICTED: molybdopterin synthase sulfur car... 113 6e-23 gb|AFK46858.1| unknown [Lotus japonicus] 113 6e-23 ref|XP_010687616.1| PREDICTED: molybdopterin synthase sulfur car... 112 7e-23 ref|XP_004290242.1| PREDICTED: molybdopterin synthase sulfur car... 112 7e-23 ref|XP_012452184.1| PREDICTED: molybdopterin synthase sulfur car... 110 5e-22 >ref|XP_011101556.1| PREDICTED: molybdopterin synthase sulfur carrier subunit [Sesamum indicum] gi|747106529|ref|XP_011101557.1| PREDICTED: molybdopterin synthase sulfur carrier subunit [Sesamum indicum] Length = 105 Score = 124 bits (310), Expect = 3e-26 Identities = 62/88 (70%), Positives = 72/88 (81%) Frame = -2 Query: 401 TGNVEGDEEEKDSRSVVIKVLFFARARDLTGLTDMPLEVSPSSTADDCLNKLIAKFPSLE 222 +G ++ +EEK+ SV IKVLFFARARDLTG+TD LEVSP +TA DCLNKLI KFP LE Sbjct: 10 SGKMDNRKEEKEDISVQIKVLFFARARDLTGMTDTMLEVSPGTTAHDCLNKLIIKFPGLE 69 Query: 221 EICDCMVLALNEEYASKSTIVKDRDELA 138 EI +CMVLALNEEY +S +VKDRDELA Sbjct: 70 EIRNCMVLALNEEYTPESAVVKDRDELA 97 >ref|XP_002525500.1| conserved hypothetical protein [Ricinus communis] gi|223535179|gb|EEF36858.1| conserved hypothetical protein [Ricinus communis] Length = 103 Score = 122 bits (306), Expect = 9e-26 Identities = 59/89 (66%), Positives = 74/89 (83%) Frame = -2 Query: 404 KTGNVEGDEEEKDSRSVVIKVLFFARARDLTGLTDMPLEVSPSSTADDCLNKLIAKFPSL 225 K+GN+E E + S+ IKVLFFARARDLTGL++MPLEVS ST +DCLNKL+A+FPSL Sbjct: 7 KSGNIESKHVESNGSSIKIKVLFFARARDLTGLSEMPLEVSSGSTTNDCLNKLVAQFPSL 66 Query: 224 EEICDCMVLALNEEYASKSTIVKDRDELA 138 EEI C+VLALNEEY ++S IV+++DELA Sbjct: 67 EEIRRCIVLALNEEYTTESAIVREKDELA 95 >ref|XP_006478433.1| PREDICTED: molybdopterin synthase sulfur carrier subunit-like isoform X1 [Citrus sinensis] gi|568849374|ref|XP_006478434.1| PREDICTED: molybdopterin synthase sulfur carrier subunit-like isoform X2 [Citrus sinensis] gi|641827675|gb|KDO46852.1| hypothetical protein CISIN_1g034057mg [Citrus sinensis] gi|641827676|gb|KDO46853.1| hypothetical protein CISIN_1g034057mg [Citrus sinensis] gi|641827677|gb|KDO46854.1| hypothetical protein CISIN_1g034057mg [Citrus sinensis] Length = 105 Score = 119 bits (298), Expect = 8e-25 Identities = 61/89 (68%), Positives = 69/89 (77%) Frame = -2 Query: 404 KTGNVEGDEEEKDSRSVVIKVLFFARARDLTGLTDMPLEVSPSSTADDCLNKLIAKFPSL 225 KTGN + + S+ IKVLFFARARDLTGLTDMPLEVS ST DCLNKLIA+FP+L Sbjct: 9 KTGNSDSALVDNKESSIQIKVLFFARARDLTGLTDMPLEVSCGSTTQDCLNKLIARFPNL 68 Query: 224 EEICDCMVLALNEEYASKSTIVKDRDELA 138 EEI CMVLALNEEY + S IV ++DELA Sbjct: 69 EEIRGCMVLALNEEYTNASVIVNEKDELA 97 >ref|XP_006441691.1| hypothetical protein CICLE_v10022992mg [Citrus clementina] gi|557543953|gb|ESR54931.1| hypothetical protein CICLE_v10022992mg [Citrus clementina] Length = 105 Score = 119 bits (298), Expect = 8e-25 Identities = 61/89 (68%), Positives = 69/89 (77%) Frame = -2 Query: 404 KTGNVEGDEEEKDSRSVVIKVLFFARARDLTGLTDMPLEVSPSSTADDCLNKLIAKFPSL 225 KTGN + + S+ IKVLFFARARDLTGLTDMPLEVS ST DCLNKLIA+FP+L Sbjct: 9 KTGNSDSALVDNKESSIQIKVLFFARARDLTGLTDMPLEVSYGSTTQDCLNKLIARFPNL 68 Query: 224 EEICDCMVLALNEEYASKSTIVKDRDELA 138 EEI CMVLALNEEY + S IV ++DELA Sbjct: 69 EEIRGCMVLALNEEYTNASVIVNEKDELA 97 >ref|XP_012854939.1| PREDICTED: molybdopterin synthase sulfur carrier subunit [Erythranthe guttatus] gi|604303240|gb|EYU22713.1| hypothetical protein MIMGU_mgv1a024016mg [Erythranthe guttata] Length = 91 Score = 117 bits (292), Expect = 4e-24 Identities = 58/82 (70%), Positives = 69/82 (84%) Frame = -2 Query: 383 DEEEKDSRSVVIKVLFFARARDLTGLTDMPLEVSPSSTADDCLNKLIAKFPSLEEICDCM 204 D E+++ S+ IKVLFFARARDLTG+TDM LEVSP +TA CL+K+I KFP LEEI +CM Sbjct: 2 DSEKEERISIKIKVLFFARARDLTGMTDMSLEVSPGTTALGCLDKVITKFPGLEEIRNCM 61 Query: 203 VLALNEEYASKSTIVKDRDELA 138 VLALNEEY +ST+VKDRDELA Sbjct: 62 VLALNEEYTPESTVVKDRDELA 83 >ref|XP_002274036.1| PREDICTED: molybdopterin synthase sulfur carrier subunit [Vitis vinifera] gi|731436282|ref|XP_010645854.1| PREDICTED: molybdopterin synthase sulfur carrier subunit [Vitis vinifera] gi|731436284|ref|XP_010645855.1| PREDICTED: molybdopterin synthase sulfur carrier subunit [Vitis vinifera] gi|297740933|emb|CBI31245.3| unnamed protein product [Vitis vinifera] Length = 106 Score = 115 bits (289), Expect = 9e-24 Identities = 61/86 (70%), Positives = 67/86 (77%), Gaps = 1/86 (1%) Frame = -2 Query: 392 VEGDEEEKDSRSVVIKVLFFARARDLTG-LTDMPLEVSPSSTADDCLNKLIAKFPSLEEI 216 V+ + D SV IK LFFARARDLTG LTDMP+EV STA DCLNKL+AKFP LEEI Sbjct: 13 VDSTNKGSDGSSVGIKFLFFARARDLTGGLTDMPMEVPSGSTAHDCLNKLVAKFPRLEEI 72 Query: 215 CDCMVLALNEEYASKSTIVKDRDELA 138 CMVLALNEEY +ST+VKDRDELA Sbjct: 73 RGCMVLALNEEYTPESTVVKDRDELA 98 >ref|XP_002325503.1| molybdenum cofactor synthesis family protein [Populus trichocarpa] gi|222862378|gb|EEE99884.1| molybdenum cofactor synthesis family protein [Populus trichocarpa] Length = 101 Score = 115 bits (289), Expect = 9e-24 Identities = 58/89 (65%), Positives = 69/89 (77%) Frame = -2 Query: 404 KTGNVEGDEEEKDSRSVVIKVLFFARARDLTGLTDMPLEVSPSSTADDCLNKLIAKFPSL 225 K N +G+ + SV IKVLFFARARD+TGL DM LEVS ST DCLNKLIA+FPSL Sbjct: 5 KAENTDGEPVGSEGSSVSIKVLFFARARDITGLADMQLEVSSGSTTSDCLNKLIARFPSL 64 Query: 224 EEICDCMVLALNEEYASKSTIVKDRDELA 138 EEI C+VLALNEEY +++ IVK++DELA Sbjct: 65 EEIRGCIVLALNEEYTTEAAIVKEKDELA 93 >ref|NP_001238656.1| uncharacterized protein LOC100527353 [Glycine max] gi|571457939|ref|XP_006580958.1| PREDICTED: uncharacterized protein LOC100527353 isoform X1 [Glycine max] gi|571457941|ref|XP_006580959.1| PREDICTED: uncharacterized protein LOC100527353 isoform X2 [Glycine max] gi|255632153|gb|ACU16429.1| unknown [Glycine max] gi|734374030|gb|KHN20574.1| Molybdopterin synthase sulfur carrier subunit [Glycine soja] Length = 102 Score = 115 bits (289), Expect = 9e-24 Identities = 60/87 (68%), Positives = 71/87 (81%), Gaps = 2/87 (2%) Frame = -2 Query: 392 VEGDE--EEKDSRSVVIKVLFFARARDLTGLTDMPLEVSPSSTADDCLNKLIAKFPSLEE 219 ++GD+ ++K+S V IKVLFFARARDLTGL+++PLEVS ST DCL KL KFPSLEE Sbjct: 8 LDGDDTHKKKESSLVKIKVLFFARARDLTGLSELPLEVSSGSTTHDCLKKLFVKFPSLEE 67 Query: 218 ICDCMVLALNEEYASKSTIVKDRDELA 138 I CMVLALNEEY ++STIVKD DELA Sbjct: 68 IRGCMVLALNEEYTTESTIVKDTDELA 94 >ref|XP_011008177.1| PREDICTED: molybdopterin synthase sulfur carrier subunit [Populus euphratica] gi|743927973|ref|XP_011008178.1| PREDICTED: molybdopterin synthase sulfur carrier subunit [Populus euphratica] Length = 101 Score = 115 bits (288), Expect = 1e-23 Identities = 58/89 (65%), Positives = 69/89 (77%) Frame = -2 Query: 404 KTGNVEGDEEEKDSRSVVIKVLFFARARDLTGLTDMPLEVSPSSTADDCLNKLIAKFPSL 225 K N +G+ + SV IKVLFFARARD+TGL DM LEVS ST DCLNKLIA+FPSL Sbjct: 5 KAENTDGEPVGSEGSSVSIKVLFFARARDVTGLADMQLEVSSGSTTSDCLNKLIARFPSL 64 Query: 224 EEICDCMVLALNEEYASKSTIVKDRDELA 138 EEI C+VLALNEEY +++ IVK++DELA Sbjct: 65 EEIRGCIVLALNEEYTTEAAIVKEKDELA 93 >ref|XP_007200636.1| hypothetical protein PRUPE_ppa013746mg [Prunus persica] gi|462396036|gb|EMJ01835.1| hypothetical protein PRUPE_ppa013746mg [Prunus persica] Length = 105 Score = 115 bits (287), Expect = 1e-23 Identities = 58/89 (65%), Positives = 70/89 (78%) Frame = -2 Query: 404 KTGNVEGDEEEKDSRSVVIKVLFFARARDLTGLTDMPLEVSPSSTADDCLNKLIAKFPSL 225 KT ++ + + SV IKV+FFARARDLTGL++MPLEVS S+ADDCLNKLIA FP L Sbjct: 9 KTVTLDSTSKGIEGSSVKIKVMFFARARDLTGLSEMPLEVSTGSSADDCLNKLIAMFPGL 68 Query: 224 EEICDCMVLALNEEYASKSTIVKDRDELA 138 E+ CMVLALNEEY ++S IVKD+DELA Sbjct: 69 TELRGCMVLALNEEYTTESAIVKDKDELA 97 >ref|XP_008237751.1| PREDICTED: molybdopterin synthase sulfur carrier subunit [Prunus mume] Length = 105 Score = 114 bits (286), Expect = 2e-23 Identities = 58/89 (65%), Positives = 70/89 (78%) Frame = -2 Query: 404 KTGNVEGDEEEKDSRSVVIKVLFFARARDLTGLTDMPLEVSPSSTADDCLNKLIAKFPSL 225 KT ++ + + SV IKV+FFARARDLTGL++MPLEVS S+ADDCLNKLIA FP L Sbjct: 9 KTVTMDSTTKGIEGSSVKIKVMFFARARDLTGLSEMPLEVSTGSSADDCLNKLIAMFPGL 68 Query: 224 EEICDCMVLALNEEYASKSTIVKDRDELA 138 E+ CMVLALNEEY ++S IVKD+DELA Sbjct: 69 TELRGCMVLALNEEYTTESAIVKDKDELA 97 >ref|XP_007019912.1| Cell wall / vacuolar inhibitor of fructosidase 1, putative isoform 2 [Theobroma cacao] gi|508725240|gb|EOY17137.1| Cell wall / vacuolar inhibitor of fructosidase 1, putative isoform 2 [Theobroma cacao] Length = 103 Score = 114 bits (286), Expect = 2e-23 Identities = 56/89 (62%), Positives = 70/89 (78%) Frame = -2 Query: 404 KTGNVEGDEEEKDSRSVVIKVLFFARARDLTGLTDMPLEVSPSSTADDCLNKLIAKFPSL 225 K ++ G + SV IKVLFFA+ARD+TGLTD+PLEVS ST DCLNKL+AKFP+L Sbjct: 7 KKDSLGGTPVVDEGSSVQIKVLFFAKARDITGLTDLPLEVSSGSTTQDCLNKLVAKFPNL 66 Query: 224 EEICDCMVLALNEEYASKSTIVKDRDELA 138 E+I C+VLALNEEY ++S +VKD+DELA Sbjct: 67 EDIRGCIVLALNEEYTTESAVVKDKDELA 95 >ref|XP_007019911.1| Cell wall / vacuolar inhibitor of fructosidase 1, putative isoform 1 [Theobroma cacao] gi|508725239|gb|EOY17136.1| Cell wall / vacuolar inhibitor of fructosidase 1, putative isoform 1 [Theobroma cacao] Length = 263 Score = 114 bits (286), Expect = 2e-23 Identities = 56/89 (62%), Positives = 70/89 (78%) Frame = -2 Query: 404 KTGNVEGDEEEKDSRSVVIKVLFFARARDLTGLTDMPLEVSPSSTADDCLNKLIAKFPSL 225 K ++ G + SV IKVLFFA+ARD+TGLTD+PLEVS ST DCLNKL+AKFP+L Sbjct: 7 KKDSLGGTPVVDEGSSVQIKVLFFAKARDITGLTDLPLEVSSGSTTQDCLNKLVAKFPNL 66 Query: 224 EEICDCMVLALNEEYASKSTIVKDRDELA 138 E+I C+VLALNEEY ++S +VKD+DELA Sbjct: 67 EDIRGCIVLALNEEYTTESAVVKDKDELA 95 >gb|AFK35775.1| unknown [Medicago truncatula] gi|657391696|gb|AES68468.2| molybdopterin synthase sulfur carrier subunit [Medicago truncatula] Length = 103 Score = 113 bits (283), Expect = 4e-23 Identities = 61/92 (66%), Positives = 72/92 (78%), Gaps = 5/92 (5%) Frame = -2 Query: 398 GNV---EGDEEE--KDSRSVVIKVLFFARARDLTGLTDMPLEVSPSSTADDCLNKLIAKF 234 GNV +GD+ + ++S V IKVLFFARARDLTGL+++PLEVS ST DCL KL+ +F Sbjct: 4 GNVSIGDGDQTQTKRESSLVKIKVLFFARARDLTGLSEVPLEVSSGSTTQDCLKKLLVQF 63 Query: 233 PSLEEICDCMVLALNEEYASKSTIVKDRDELA 138 PSLEEI CMVLALNEEY STIVKD+DELA Sbjct: 64 PSLEEIKGCMVLALNEEYTMDSTIVKDKDELA 95 >ref|XP_003598217.1| Molybdopterin synthase sulfur carrier subunit [Medicago truncatula] Length = 102 Score = 113 bits (283), Expect = 4e-23 Identities = 61/92 (66%), Positives = 72/92 (78%), Gaps = 5/92 (5%) Frame = -2 Query: 398 GNV---EGDEEE--KDSRSVVIKVLFFARARDLTGLTDMPLEVSPSSTADDCLNKLIAKF 234 GNV +GD+ + ++S V IKVLFFARARDLTGL+++PLEVS ST DCL KL+ +F Sbjct: 3 GNVSIGDGDQTQTKRESSLVKIKVLFFARARDLTGLSEVPLEVSSGSTTQDCLKKLLVQF 62 Query: 233 PSLEEICDCMVLALNEEYASKSTIVKDRDELA 138 PSLEEI CMVLALNEEY STIVKD+DELA Sbjct: 63 PSLEEIKGCMVLALNEEYTMDSTIVKDKDELA 94 >ref|XP_012076932.1| PREDICTED: molybdopterin synthase sulfur carrier subunit [Jatropha curcas] gi|643739909|gb|KDP45595.1| hypothetical protein JCGZ_17202 [Jatropha curcas] Length = 103 Score = 113 bits (282), Expect = 6e-23 Identities = 55/89 (61%), Positives = 70/89 (78%) Frame = -2 Query: 404 KTGNVEGDEEEKDSRSVVIKVLFFARARDLTGLTDMPLEVSPSSTADDCLNKLIAKFPSL 225 KT NV + SV IKVLFFARARDLTGLT++PLEVS +T DCL+KL++KFP L Sbjct: 7 KTNNVNTRPVGNEDSSVKIKVLFFARARDLTGLTEVPLEVSSGATTSDCLDKLVSKFPGL 66 Query: 224 EEICDCMVLALNEEYASKSTIVKDRDELA 138 +EI +C+V+ALNEEY ++S +VKD+DELA Sbjct: 67 QEIRNCIVVALNEEYTTESAVVKDKDELA 95 >gb|AFK46858.1| unknown [Lotus japonicus] Length = 103 Score = 113 bits (282), Expect = 6e-23 Identities = 59/86 (68%), Positives = 70/86 (81%), Gaps = 2/86 (2%) Frame = -2 Query: 389 EGDE--EEKDSRSVVIKVLFFARARDLTGLTDMPLEVSPSSTADDCLNKLIAKFPSLEEI 216 +GD +K+S V IKVLFFARARDLTGL+++PLEV+ ST DCL KL+A+FPSLEEI Sbjct: 10 DGDNMHSKKESALVKIKVLFFARARDLTGLSEVPLEVTSGSTTRDCLKKLLAQFPSLEEI 69 Query: 215 CDCMVLALNEEYASKSTIVKDRDELA 138 CMVLALNEEY ++STIVKD DELA Sbjct: 70 QGCMVLALNEEYTTESTIVKDTDELA 95 >ref|XP_010687616.1| PREDICTED: molybdopterin synthase sulfur carrier subunit [Beta vulgaris subsp. vulgaris] gi|731352575|ref|XP_010687617.1| PREDICTED: molybdopterin synthase sulfur carrier subunit [Beta vulgaris subsp. vulgaris] gi|870851403|gb|KMT03450.1| hypothetical protein BVRB_8g191340 [Beta vulgaris subsp. vulgaris] Length = 102 Score = 112 bits (281), Expect = 7e-23 Identities = 57/87 (65%), Positives = 68/87 (78%) Frame = -2 Query: 398 GNVEGDEEEKDSRSVVIKVLFFARARDLTGLTDMPLEVSPSSTADDCLNKLIAKFPSLEE 219 GN +G E S+ +KVLFFARARDLTGL DMPLEV+ STA DCL+K++ +FP LE+ Sbjct: 11 GNTDGRNGES---SIELKVLFFARARDLTGLADMPLEVTSGSTARDCLDKIVTRFPGLED 67 Query: 218 ICDCMVLALNEEYASKSTIVKDRDELA 138 I CMVLALNEEYAS+S +VK RDELA Sbjct: 68 IRGCMVLALNEEYASESAVVKHRDELA 94 >ref|XP_004290242.1| PREDICTED: molybdopterin synthase sulfur carrier subunit [Fragaria vesca subsp. vesca] Length = 105 Score = 112 bits (281), Expect = 7e-23 Identities = 56/74 (75%), Positives = 65/74 (87%) Frame = -2 Query: 359 SVVIKVLFFARARDLTGLTDMPLEVSPSSTADDCLNKLIAKFPSLEEICDCMVLALNEEY 180 SV +KVLFFARARDLTG T+MPLEVS STA+DCLNKLI+ FPSLEEI CMVLALNEEY Sbjct: 24 SVKMKVLFFARARDLTGFTEMPLEVSSGSTANDCLNKLISIFPSLEEIRGCMVLALNEEY 83 Query: 179 ASKSTIVKDRDELA 138 ++S +V+D+DELA Sbjct: 84 TTESAVVQDKDELA 97 >ref|XP_012452184.1| PREDICTED: molybdopterin synthase sulfur carrier subunit [Gossypium raimondii] gi|823239051|ref|XP_012452185.1| PREDICTED: molybdopterin synthase sulfur carrier subunit [Gossypium raimondii] gi|763800761|gb|KJB67716.1| hypothetical protein B456_010G205800 [Gossypium raimondii] gi|763800762|gb|KJB67717.1| hypothetical protein B456_010G205800 [Gossypium raimondii] Length = 101 Score = 110 bits (274), Expect = 5e-22 Identities = 52/78 (66%), Positives = 65/78 (83%) Frame = -2 Query: 371 KDSRSVVIKVLFFARARDLTGLTDMPLEVSPSSTADDCLNKLIAKFPSLEEICDCMVLAL 192 KD V IKVLFFA+ARD+TGLT++ +EVS ST DCLNKL+AKFP+L+EI C+VLAL Sbjct: 16 KDGSFVQIKVLFFAKARDITGLTELSMEVSSGSTTQDCLNKLVAKFPNLDEIRQCIVLAL 75 Query: 191 NEEYASKSTIVKDRDELA 138 NEEY ++S +VKD+DELA Sbjct: 76 NEEYTTESAVVKDKDELA 93