BLASTX nr result
ID: Forsythia21_contig00024677
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00024677 (284 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098716.1| PREDICTED: BAG family molecular chaperone re... 71 2e-10 ref|XP_012840595.1| PREDICTED: BAG family molecular chaperone re... 62 2e-07 ref|XP_010661126.1| PREDICTED: BAG family molecular chaperone re... 62 2e-07 emb|CAN68960.1| hypothetical protein VITISV_019275 [Vitis vinifera] 62 2e-07 ref|XP_012840597.1| PREDICTED: BAG family molecular chaperone re... 61 3e-07 ref|XP_009603905.1| PREDICTED: BAG family molecular chaperone re... 56 8e-06 >ref|XP_011098716.1| PREDICTED: BAG family molecular chaperone regulator 8, chloroplastic [Sesamum indicum] Length = 431 Score = 71.2 bits (173), Expect = 2e-10 Identities = 44/81 (54%), Positives = 54/81 (66%), Gaps = 13/81 (16%) Frame = -1 Query: 206 PHTLYTQPHL--SYHHF-HFQEPYFQEEQPMHPT-VSFVRRIAVLESSFH---------R 66 P+ Q HL S H++ HF+E FQEE+ HPT VS +RRIAVLES+ H R Sbjct: 43 PNLCSAQTHLPNSQHYYPHFRESSFQEERQTHPTIVSLLRRIAVLESALHSRSSSLQSVR 102 Query: 65 HVAARTIQTHFRAFLVRRSRT 3 AARTIQ++FRAFL+RRSRT Sbjct: 103 DAAARTIQSYFRAFLLRRSRT 123 >ref|XP_012840595.1| PREDICTED: BAG family molecular chaperone regulator 8, chloroplastic isoform X1 [Erythranthe guttatus] gi|848880429|ref|XP_012840596.1| PREDICTED: BAG family molecular chaperone regulator 8, chloroplastic isoform X2 [Erythranthe guttatus] Length = 430 Score = 61.6 bits (148), Expect = 2e-07 Identities = 44/85 (51%), Positives = 49/85 (57%), Gaps = 17/85 (20%) Frame = -1 Query: 206 PHTLYTQPHL----SYHHFHFQEPYFQEEQPMHPTVS-FVRRIAVLES----------SF 72 PH T PHL Y+ H Q YFQEE +P VS +RRIA LES SF Sbjct: 50 PHPYSTIPHLPNPPQYNEPH-QNHYFQEEIRTYPAVSSLLRRIAALESALGRRSSHSSSF 108 Query: 71 H--RHVAARTIQTHFRAFLVRRSRT 3 H R AARTIQTHFR+FL+RRS T Sbjct: 109 HSLRDAAARTIQTHFRSFLLRRSAT 133 >ref|XP_010661126.1| PREDICTED: BAG family molecular chaperone regulator 8, chloroplastic [Vitis vinifera] Length = 456 Score = 61.6 bits (148), Expect = 2e-07 Identities = 41/84 (48%), Positives = 50/84 (59%), Gaps = 16/84 (19%) Frame = -1 Query: 206 PHTLYTQP--HLSYHHFHFQEPYF----QEEQPMHPTVS-FVRRIAVLESSFH------- 69 PH T P H+S++++H Q P F Q++Q H +S +RRI LESS Sbjct: 61 PHLYSTFPKSHISHNNYHPQRPSFLQEQQQQQQTHTLLSSLLRRIDALESSLLHFSTPSY 120 Query: 68 --RHVAARTIQTHFRAFLVRRSRT 3 R AARTIQTHFRAFLVRRSRT Sbjct: 121 SLRDAAARTIQTHFRAFLVRRSRT 144 >emb|CAN68960.1| hypothetical protein VITISV_019275 [Vitis vinifera] Length = 477 Score = 61.6 bits (148), Expect = 2e-07 Identities = 41/84 (48%), Positives = 50/84 (59%), Gaps = 16/84 (19%) Frame = -1 Query: 206 PHTLYTQP--HLSYHHFHFQEPYF----QEEQPMHPTVS-FVRRIAVLESSFH------- 69 PH T P H+S++++H Q P F Q++Q H +S +RRI LESS Sbjct: 61 PHLYSTFPKSHISHNNYHPQRPSFLQEQQQQQQTHTLLSSLLRRIDALESSLLHFSTPSY 120 Query: 68 --RHVAARTIQTHFRAFLVRRSRT 3 R AARTIQTHFRAFLVRRSRT Sbjct: 121 SLRDAAARTIQTHFRAFLVRRSRT 144 >ref|XP_012840597.1| PREDICTED: BAG family molecular chaperone regulator 8, chloroplastic isoform X3 [Erythranthe guttatus] Length = 428 Score = 60.8 bits (146), Expect = 3e-07 Identities = 44/85 (51%), Positives = 49/85 (57%), Gaps = 17/85 (20%) Frame = -1 Query: 206 PHTLYTQPHL----SYHHFHFQEPYFQEEQPMHPTVS-FVRRIAVLES----------SF 72 PH T PHL Y+ H Q YFQEE +P VS +RRIA LES SF Sbjct: 50 PHPYSTIPHLPNPPQYNEPH-QNHYFQEEIRTYPAVSSLLRRIAALESALGRRSSHSSSF 108 Query: 71 H--RHVAARTIQTHFRAFLVRRSRT 3 H R AARTIQTHFR+FL+RRS T Sbjct: 109 HSLRDAAARTIQTHFRSFLLRRSVT 133 >ref|XP_009603905.1| PREDICTED: BAG family molecular chaperone regulator 8, chloroplastic [Nicotiana tomentosiformis] Length = 426 Score = 56.2 bits (134), Expect = 8e-06 Identities = 35/76 (46%), Positives = 41/76 (53%), Gaps = 15/76 (19%) Frame = -1 Query: 185 PHLSYHHFHF--QEPYFQEEQPMHPTVSFVRRIAVLESSFHRH-------------VAAR 51 PH ++H+F Q Q++Q S +RRIA LESS R AAR Sbjct: 77 PHQNHHYFEEVNQANKVQDQQTQRIVTSLLRRIAALESSLRRSSSSSPRYRQSLRDAAAR 136 Query: 50 TIQTHFRAFLVRRSRT 3 TIQTHFRAFL RRSRT Sbjct: 137 TIQTHFRAFLARRSRT 152