BLASTX nr result
ID: Forsythia21_contig00024483
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00024483 (200 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011083009.1| PREDICTED: trihelix transcription factor ASI... 59 1e-06 >ref|XP_011083009.1| PREDICTED: trihelix transcription factor ASIL2 [Sesamum indicum] Length = 363 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -3 Query: 198 SNGRYASTWPHFDSLDSLIGDTFAKVNSVPSNGHKKNL 85 SNGRY STWPHF SLDSLIGD+F+K ++ +NGH +NL Sbjct: 137 SNGRYVSTWPHFQSLDSLIGDSFSKTSN-NANGHNRNL 173