BLASTX nr result
ID: Forsythia21_contig00024441
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00024441 (911 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006432873.1| hypothetical protein CICLE_v10003717mg [Citr... 59 5e-06 >ref|XP_006432873.1| hypothetical protein CICLE_v10003717mg [Citrus clementina] gi|557534995|gb|ESR46113.1| hypothetical protein CICLE_v10003717mg [Citrus clementina] Length = 451 Score = 58.9 bits (141), Expect = 5e-06 Identities = 32/62 (51%), Positives = 40/62 (64%) Frame = +3 Query: 450 MTIKFDNAPGDASTFHKFLIV*SELSP*KPIT*LLDLIIYHCTSFPPSYDP*FNKTFVSC 629 +T FD+A GDASTF KFL+ SE++ KPIT DL FPPSY P ++TFV C Sbjct: 155 ITFSFDHALGDASTFGKFLVSWSEIAQQKPITCSPDLRRNLRARFPPSYHPSLDQTFVKC 214 Query: 630 TL 635 T+ Sbjct: 215 TI 216