BLASTX nr result
ID: Forsythia21_contig00024396
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00024396 (280 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011100744.1| PREDICTED: probable WRKY transcription facto... 65 1e-08 ref|XP_006354313.1| PREDICTED: probable WRKY transcription facto... 61 3e-07 ref|XP_011071373.1| PREDICTED: probable WRKY transcription facto... 59 1e-06 ref|XP_007035843.1| WRKY DNA-binding protein 48, putative isofor... 59 1e-06 ref|XP_007035842.1| WRKY DNA-binding protein 48, putative isofor... 59 1e-06 ref|XP_002519250.1| WRKY transcription factor, putative [Ricinus... 57 5e-06 ref|XP_009626377.1| PREDICTED: probable WRKY transcription facto... 57 6e-06 >ref|XP_011100744.1| PREDICTED: probable WRKY transcription factor 48 [Sesamum indicum] Length = 303 Score = 65.5 bits (158), Expect = 1e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -2 Query: 279 SIVVTTYEGSHTHPCPITPRGSFGFIPENTTF 184 SIVVTTYEG+HTHPCPITPRGSFG +PE TTF Sbjct: 177 SIVVTTYEGTHTHPCPITPRGSFGVMPEATTF 208 >ref|XP_006354313.1| PREDICTED: probable WRKY transcription factor 48-like [Solanum tuberosum] Length = 339 Score = 60.8 bits (146), Expect = 3e-07 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -2 Query: 279 SIVVTTYEGSHTHPCPITPRGSFGFIPENTTF 184 SIVVTTYEG HTHPCP+TPRGS GF PE T + Sbjct: 209 SIVVTTYEGVHTHPCPVTPRGSIGFFPETTGY 240 >ref|XP_011071373.1| PREDICTED: probable WRKY transcription factor 48 [Sesamum indicum] Length = 372 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -2 Query: 279 SIVVTTYEGSHTHPCPITPRGSFGFIPENT 190 SIVVTTYEG+HTHPCPITPRGS+G +P T Sbjct: 229 SIVVTTYEGTHTHPCPITPRGSYGLMPAET 258 >ref|XP_007035843.1| WRKY DNA-binding protein 48, putative isoform 2 [Theobroma cacao] gi|508714872|gb|EOY06769.1| WRKY DNA-binding protein 48, putative isoform 2 [Theobroma cacao] Length = 354 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -2 Query: 279 SIVVTTYEGSHTHPCPITPRGSFGFIPENTTF 184 ++VVTTYEG HTHPCPITPRGS G P+++TF Sbjct: 238 TVVVTTYEGQHTHPCPITPRGSIGISPDSSTF 269 >ref|XP_007035842.1| WRKY DNA-binding protein 48, putative isoform 1 [Theobroma cacao] gi|508714871|gb|EOY06768.1| WRKY DNA-binding protein 48, putative isoform 1 [Theobroma cacao] Length = 361 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -2 Query: 279 SIVVTTYEGSHTHPCPITPRGSFGFIPENTTF 184 ++VVTTYEG HTHPCPITPRGS G P+++TF Sbjct: 245 TVVVTTYEGQHTHPCPITPRGSIGISPDSSTF 276 >ref|XP_002519250.1| WRKY transcription factor, putative [Ricinus communis] gi|223541565|gb|EEF43114.1| WRKY transcription factor, putative [Ricinus communis] Length = 351 Score = 57.0 bits (136), Expect = 5e-06 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = -2 Query: 279 SIVVTTYEGSHTHPCPITPRGSFGFIPENTTF 184 +IVVTTYEG HTHP P+TPRGS GF+P+++ F Sbjct: 233 TIVVTTYEGQHTHPSPVTPRGSIGFLPDSSAF 264 >ref|XP_009626377.1| PREDICTED: probable WRKY transcription factor 48 [Nicotiana tomentosiformis] Length = 322 Score = 56.6 bits (135), Expect = 6e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -2 Query: 279 SIVVTTYEGSHTHPCPITPRGSFGFIPENTTF 184 SIVVTTYEG HTHPCPITPR S G +PE T + Sbjct: 203 SIVVTTYEGIHTHPCPITPRTSIGILPEATAY 234